BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0377 (747 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 23 3.4 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 23 3.4 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 21 7.9 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 21 7.9 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 21 7.9 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 21 7.9 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 21 7.9 AF260821-1|AAG02019.1| 134|Tribolium castaneum alpha-esterase l... 21 7.9 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 21 7.9 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -2 Query: 461 RKLRPSQPDRPRQWSPCSKFRPPSRARAGT 372 + L S PD +W P ++ P ARA + Sbjct: 106 QSLDASDPDAMGKWCPRREWSSPPDARAAS 135 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -2 Query: 461 RKLRPSQPDRPRQWSPCSKFRPPSRARAGT 372 + L S PD +W P ++ P ARA + Sbjct: 262 QSLDASDPDAMGKWCPRREWSSPPDARAAS 291 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = +2 Query: 308 MATNNTNGHCENYHKMESLKKLFQPVHEK 394 + T + N H +H E + QP H++ Sbjct: 157 LTTQSMNNHHMGHHMQEQHPQHHQPHHQQ 185 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 502 Y*SDVIRNILRQHRESCGHPNLTDPDNG 419 Y D++ N+ Q E C N+ P NG Sbjct: 65 YSKDLLFNLPAQGSEDCLFLNVYTPKNG 92 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 502 Y*SDVIRNILRQHRESCGHPNLTDPDNG 419 Y D++ N+ Q E C N+ P NG Sbjct: 67 YSKDLLFNLPAQGSEDCLFLNVYTPKNG 94 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 502 Y*SDVIRNILRQHRESCGHPNLTDPDNG 419 Y D++ N+ Q E C N+ P NG Sbjct: 65 YSKDLLFNLPAQGSEDCLFLNVYTPKNG 92 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 502 Y*SDVIRNILRQHRESCGHPNLTDPDNG 419 Y D++ N+ Q E C N+ P NG Sbjct: 67 YSKDLLFNLPAQGSEDCLFLNVYTPKNG 94 >AF260821-1|AAG02019.1| 134|Tribolium castaneum alpha-esterase like protein E2 protein. Length = 134 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 502 Y*SDVIRNILRQHRESCGHPNLTDPDNG 419 Y D++ N+ Q E C N+ P NG Sbjct: 39 YSKDLLFNLPAQGSEDCLFLNVYTPKNG 66 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = +2 Query: 308 MATNNTNGHCENYHKMESLKKLFQPVHEK 394 + T + N H +H E + QP H++ Sbjct: 159 LTTQSMNNHHMGHHMQEQHPQHHQPHHQQ 187 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,858 Number of Sequences: 336 Number of extensions: 3182 Number of successful extensions: 14 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19923648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -