BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0375 (709 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2F7.11 |nrd1|msa2|RNA-binding protein Nrd1|Schizosaccharomyc... 29 0.49 SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual 26 4.6 SPAC19D5.04 |ptr1||HECT domain|Schizosaccharomyces pombe|chr 1||... 26 4.6 >SPAC2F7.11 |nrd1|msa2|RNA-binding protein Nrd1|Schizosaccharomyces pombe|chr 1|||Manual Length = 529 Score = 29.5 bits (63), Expect = 0.49 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = +3 Query: 501 PSGYLQVRADICRTDRTTYACAIYAVNGLYQ--SITKAGIRHNLKLITDKTICF 656 PS LQ I +RT Y I+A + + + + G+ HN++ + +K ICF Sbjct: 308 PSPVLQKPDLIMTGNRTVYIGNIHADTTIEEICNAVRGGLLHNIRYLQEKHICF 361 >SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual Length = 1828 Score = 26.2 bits (55), Expect = 4.6 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -1 Query: 370 HSFYIGLLRHLRFISIRAFVFLYNICYGNYTI 275 H FY +LR F+ +N+ YG Y I Sbjct: 857 HLFYTKCYSYLRQCKSSPFINFWNVSYGKYLI 888 >SPAC19D5.04 |ptr1||HECT domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 3227 Score = 26.2 bits (55), Expect = 4.6 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +2 Query: 20 LVETLCRTPIISKIFVPAL 76 L+E+LC+ P+++ I PAL Sbjct: 2459 LLESLCKVPVVNGISAPAL 2477 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,900,009 Number of Sequences: 5004 Number of extensions: 61284 Number of successful extensions: 113 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -