BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0375 (709 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42243| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_57604| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 >SB_42243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 762 Score = 29.5 bits (63), Expect = 2.8 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = +1 Query: 193 IQKLFLQYKITMNQKRRKKLKIVIM*TLSCNYRSRYCREKQKL*LK*SVNDVKDRCKSYE 372 +++ F +Y T K+ V + YRSR C K + K SV D+KD+ S E Sbjct: 291 VRRCFCRYAPTRAWLAPLKIHRVHDTRFNTEYRSRGCNNKHLISHKQSVEDMKDKYSSLE 350 >SB_57604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 631 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -2 Query: 540 SGKYRHAPGGNRREYQLTPQTVGTLTHRLSCSKVRVRK 427 SGK+ PG R Y +TP LTH S + ++ K Sbjct: 217 SGKFVITPGSTLRLYHVTPTDTVALTHATSLVQHKLAK 254 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,710,661 Number of Sequences: 59808 Number of extensions: 423519 Number of successful extensions: 692 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 639 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 692 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -