BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0374 (775 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26800.3 68415.m03216 hydroxymethylglutaryl-CoA lyase, putati... 30 2.0 At2g26800.2 68415.m03215 hydroxymethylglutaryl-CoA lyase, putati... 30 2.0 At2g26800.1 68415.m03214 hydroxymethylglutaryl-CoA lyase, putati... 30 2.0 At3g53540.1 68416.m05912 expressed protein 29 3.4 At4g04130.1 68417.m00583 Ulp1 protease family protein contains P... 29 4.5 At2g17590.1 68415.m02035 DC1 domain-containing protein contains ... 29 4.5 At1g59630.1 68414.m06706 F-box family protein-related contains w... 29 4.5 At4g04970.1 68417.m00722 callose synthase, putative / 1,3-beta-g... 28 6.0 At3g63500.2 68416.m07153 expressed protein 28 6.0 At3g63500.1 68416.m07152 expressed protein 28 6.0 >At2g26800.3 68415.m03216 hydroxymethylglutaryl-CoA lyase, putative / 3-hydroxy-3-methylglutarate-CoA lyase, putative / HMG-CoA lyase, putative similar to SP|P35915 Hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4) (HMG-CoA lyase) {Gallus gallus}; contains Pfam profile PF00682: HMGL-like Length = 355 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -2 Query: 306 RHPRRLQVKSRSVRRISFCHNTTFATGDLIEAIKISKRRHCTF 178 RH R+L R ISF T+ +G L E+ ++++ TF Sbjct: 105 RHTRKLSEGEHMFRNISFAGRTSTVSGTLRESKSFKEQKYSTF 147 >At2g26800.2 68415.m03215 hydroxymethylglutaryl-CoA lyase, putative / 3-hydroxy-3-methylglutarate-CoA lyase, putative / HMG-CoA lyase, putative similar to SP|P35915 Hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4) (HMG-CoA lyase) {Gallus gallus}; contains Pfam profile PF00682: HMGL-like Length = 468 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -2 Query: 306 RHPRRLQVKSRSVRRISFCHNTTFATGDLIEAIKISKRRHCTF 178 RH R+L R ISF T+ +G L E+ ++++ TF Sbjct: 105 RHTRKLSEGEHMFRNISFAGRTSTVSGTLRESKSFKEQKYSTF 147 >At2g26800.1 68415.m03214 hydroxymethylglutaryl-CoA lyase, putative / 3-hydroxy-3-methylglutarate-CoA lyase, putative / HMG-CoA lyase, putative similar to SP|P35915 Hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4) (HMG-CoA lyase) {Gallus gallus}; contains Pfam profile PF00682: HMGL-like Length = 433 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -2 Query: 306 RHPRRLQVKSRSVRRISFCHNTTFATGDLIEAIKISKRRHCTF 178 RH R+L R ISF T+ +G L E+ ++++ TF Sbjct: 70 RHTRKLSEGEHMFRNISFAGRTSTVSGTLRESKSFKEQKYSTF 112 >At3g53540.1 68416.m05912 expressed protein Length = 924 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 6/52 (11%) Frame = +1 Query: 82 KFSLGHCELLALMKEDF------KNVLQASVQKQWDEVKRAMSAFTYFDGLD 219 +F+ HCE L+ K+DF K++L + KQ + KR+ S GLD Sbjct: 42 EFNSCHCEALSENKQDFPTGVPMKSLLAQEMSKQKESKKRSPSIIARLMGLD 93 >At4g04130.1 68417.m00583 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At2g11345, At3g42690 Length = 1200 Score = 28.7 bits (61), Expect = 4.5 Identities = 26/85 (30%), Positives = 37/85 (43%), Gaps = 2/85 (2%) Frame = +2 Query: 515 RKSIERKRTESILKNSSLSKQSKHSEGNKGESVQ--ISVDGPEIIELSASTAAVPSTQEN 688 ++ + RKR + +SLS S S N G +V I VDG + L S Sbjct: 581 KQPVTRKRKREEV--TSLSSGSSSSGLNHGPAVDTDIGVDGGGTVNLEGSVDPWELYGST 638 Query: 689 RVLLDPTEQGRNSHRMSVIPEAIVD 763 + + +P E GR S S +P A D Sbjct: 639 KNISEPQEMGRES-PTSPVPTATQD 662 >At2g17590.1 68415.m02035 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 632 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -3 Query: 596 YPPNVCFASTNWNFLVYSLSFSVLC 522 +PP+ CFAS++ F+ +SL F C Sbjct: 49 HPPSGCFASSDSTFIRHSLYFYFFC 73 >At1g59630.1 68414.m06706 F-box family protein-related contains weak hit to TIGRFAM TIGR01640 : F-box protein interaction domain; similar to F-box protein family, AtFBX9 (GI:20197985) [Arabidopsis thaliana] contains weak hit to TIGRFAM TIGR01640 : F-box protein interaction domain; Length = 239 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 6/53 (11%) Frame = +2 Query: 122 KKILRMYCKLPCKNSGTKSNVQCL------RLLILMASMRSPVAKVVLWQNEI 262 K++++++C LPCK + + SN + L R +L S R+ + + + EI Sbjct: 96 KEVIKIFCILPCKANKSTSNTRILSIYKGDRFSVLQQSKRTGEINIWVTEKEI 148 >At4g04970.1 68417.m00722 callose synthase, putative / 1,3-beta-glucan synthase, putative similar to callose synthase 1 catalytic subunit GI:13649388 from [Arabidopsis thaliana] Length = 1768 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +1 Query: 388 VIFTVFMIHIYRQTRANKIWTQSILEPTITAEKVV 492 V+F+VF I+ Q + +W+++ E +T KVV Sbjct: 389 VLFSVFYARIWSQKNKDGVWSRAANERVVTFLKVV 423 >At3g63500.2 68416.m07153 expressed protein Length = 1162 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/59 (23%), Positives = 30/59 (50%) Frame = +2 Query: 572 KQSKHSEGNKGESVQISVDGPEIIELSASTAAVPSTQENRVLLDPTEQGRNSHRMSVIP 748 ++ K +GN G++ + V+GPE +E +A P+ + V + ++ + S +P Sbjct: 370 EELKEVKGNDGDANKAEVEGPECVEENALANRTPAEYISSVSDSSVHKCKDKGKNSDVP 428 >At3g63500.1 68416.m07152 expressed protein Length = 887 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/59 (23%), Positives = 30/59 (50%) Frame = +2 Query: 572 KQSKHSEGNKGESVQISVDGPEIIELSASTAAVPSTQENRVLLDPTEQGRNSHRMSVIP 748 ++ K +GN G++ + V+GPE +E +A P+ + V + ++ + S +P Sbjct: 95 EELKEVKGNDGDANKAEVEGPECVEENALANRTPAEYISSVSDSSVHKCKDKGKNSDVP 153 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,250,763 Number of Sequences: 28952 Number of extensions: 401438 Number of successful extensions: 1180 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1180 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1726528800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -