BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0371 (832 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46013| Best HMM Match : DUF1129 (HMM E-Value=0.23) 30 2.0 SB_27030| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_17622| Best HMM Match : zf-CCHC (HMM E-Value=0.3) 29 3.5 SB_40906| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_35264| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_377| Best HMM Match : IQ (HMM E-Value=0.0002) 29 6.1 SB_29028| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_14436| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_59327| Best HMM Match : DUF919 (HMM E-Value=6.3) 28 8.1 SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_9200| Best HMM Match : Peptidase_A17 (HMM E-Value=4.4e-39) 28 8.1 >SB_46013| Best HMM Match : DUF1129 (HMM E-Value=0.23) Length = 553 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/65 (24%), Positives = 29/65 (44%) Frame = +3 Query: 309 ALNERKSQDKHTENLIPNLTNSHKSYGYTGIDKDESIVSQDKVAFTNDNGNLYQSKESRS 488 ++N+ + +N I + NS + D D SI D + NDN ++Y + S Sbjct: 290 SINDNDNSINDNDNSIYDNDNSINDNDNSINDNDNSINDNDNSIYDNDNSSIYDNDNSIY 349 Query: 489 ENSGT 503 +N + Sbjct: 350 DNDNS 354 >SB_27030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/63 (23%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Frame = -3 Query: 803 TINNWGPLENSIRL-LIANLKMVTSXIIXXRLFEVILSIVLKLFGSIKNYWISL**YKDL 627 +++ + L+++I+ +K V I +F +I + LFG++K++ I+ + + Sbjct: 124 SLDRYFALKSNIKYRTTVTVKRVLISITFIWIFSIIFGVYFTLFGNVKSFSIATGSFGSI 183 Query: 626 CLF 618 CLF Sbjct: 184 CLF 186 >SB_17622| Best HMM Match : zf-CCHC (HMM E-Value=0.3) Length = 374 Score = 29.5 bits (63), Expect = 3.5 Identities = 19/83 (22%), Positives = 34/83 (40%) Frame = +3 Query: 210 PNHRKTKP*STS*PSNVENPSQRPEHRDPQDYTALNERKSQDKHTENLIPNLTNSHKSYG 389 P TK ST P Q H T ++++ KHTE + N+ S+ Sbjct: 64 PQLTPTKHSSTPTPIQTHRKPQERIHNVLLTKTEAQKKEALVKHTEKKVCPYHNNAASHN 123 Query: 390 YTGIDKDESIVSQDKVAFTNDNG 458 T + + ++ ++++ F NG Sbjct: 124 LTECKRFKELLYEERLEFLKSNG 146 >SB_40906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +3 Query: 312 LNERKSQDKHTENLIPNLT-NSHKSYGYTGIDKDESIVSQDKVAFTNDNGNLYQSKES 482 ++E + +D+ T N P L N KSY I E ++ ++ + + G+L KES Sbjct: 41 VDENEPKDEETANQTPTLKDNDEKSYYKVDIPSSEQRITVEERSDDSTRGHLGSPKES 98 >SB_35264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 619 Score = 29.1 bits (62), Expect = 4.6 Identities = 22/72 (30%), Positives = 30/72 (41%), Gaps = 3/72 (4%) Frame = +3 Query: 192 HSRSWRPNHRKTKP*STS*PSNVENPSQRPEHRD--PQDYTALNERKS-QDKHTENLIPN 362 H R R H + S S N E PS R + RD P + L +S +D T N N Sbjct: 80 HRRESRRVHVRNSRCSDSFRGNDEKPSARSDRRDRKPDNQRGLKRSRSRKDDTTANAKRN 139 Query: 363 LTNSHKSYGYTG 398 + + + Y G Sbjct: 140 RSQYQRLHSYRG 151 >SB_377| Best HMM Match : IQ (HMM E-Value=0.0002) Length = 1376 Score = 28.7 bits (61), Expect = 6.1 Identities = 18/66 (27%), Positives = 30/66 (45%) Frame = +3 Query: 300 DYTALNERKSQDKHTENLIPNLTNSHKSYGYTGIDKDESIVSQDKVAFTNDNGNLYQSKE 479 D L+ + SQ + + N H S+ G+D E++ S+D+ + T KE Sbjct: 715 DNCELSSKSSQPESEQVRESKTHNEHVSHAPDGLDTQETVGSKDEDSITERKKT--DQKE 772 Query: 480 SRSENS 497 SE+S Sbjct: 773 GNSESS 778 >SB_29028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 714 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +2 Query: 479 ISFRKLR-NLNQDTVPKIIYVQTDGLQDNQLYQVAGSSGDSIIMS 610 + RKL NL+ PK++ QTD +D + + SG ++ S Sbjct: 216 LPLRKLSSNLSMHDDPKVMKNQTDSFEDTTISLIGSKSGTTLFQS 260 >SB_14436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 765 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = +3 Query: 249 PSNVENPSQRPEHRDPQDYTALNERKSQDKHTENLIPNLTN 371 P+ ++ +Q P HR PQ+Y+ ++S+ + + P L N Sbjct: 81 PTLGDSRNQHPNHRIPQNYSLRTIKRSEIRGSTGSPPTLAN 121 >SB_59327| Best HMM Match : DUF919 (HMM E-Value=6.3) Length = 293 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +2 Query: 479 ISFRKLR-NLNQDTVPKIIYVQTDGLQDNQLYQVAGSSGDSIIMS 610 + RKL NL+ PK++ QTD +D + + SG ++ S Sbjct: 97 LPLRKLSSNLSMHDDPKVMKNQTDSFEDTTISLIGSKSGTTLFQS 141 >SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1711 Score = 28.3 bits (60), Expect = 8.1 Identities = 16/59 (27%), Positives = 27/59 (45%) Frame = +3 Query: 258 VENPSQRPEHRDPQDYTALNERKSQDKHTENLIPNLTNSHKSYGYTGIDKDESIVSQDK 434 +E + E +D T ER+ +D EN+ N+ NS S + ++ I +DK Sbjct: 976 LERRKHQEELETLKDKTLKVERELRDSQQENIKMNIENSKLSRKVSSLESSVEIFEKDK 1034 >SB_9200| Best HMM Match : Peptidase_A17 (HMM E-Value=4.4e-39) Length = 1607 Score = 28.3 bits (60), Expect = 8.1 Identities = 19/83 (22%), Positives = 33/83 (39%) Frame = +3 Query: 210 PNHRKTKP*STS*PSNVENPSQRPEHRDPQDYTALNERKSQDKHTENLIPNLTNSHKSYG 389 P TK ST P Q H T ++++ KHTE + N+ S+ Sbjct: 535 PQLTPTKHSSTPTPIQTHRKPQERIHNVLLTKTEAQKKEALVKHTEKKVCPYHNNAASHN 594 Query: 390 YTGIDKDESIVSQDKVAFTNDNG 458 T + + + ++++ F NG Sbjct: 595 LTECKRFKELPYEERLEFLKSNG 617 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,216,111 Number of Sequences: 59808 Number of extensions: 462424 Number of successful extensions: 1197 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1097 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1190 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2335516755 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -