BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0370 (711 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 23 3.8 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 22 6.6 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 22.6 bits (46), Expect = 3.8 Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -1 Query: 165 LFSLWHPQCFLKYL-LISSKIFSPLNLFYMLDY*STVLYL 49 L ++W P CF K ++ S N + L + T+LY+ Sbjct: 84 LHNIWRPDCFFKNAKKVTFHEMSIPNHYLWLYHDKTLLYM 123 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 21.8 bits (44), Expect = 6.6 Identities = 6/24 (25%), Positives = 14/24 (58%) Frame = -1 Query: 213 LWGGLFFQKASQLQKVLFSLWHPQ 142 +WG LF + + +++ + HP+ Sbjct: 314 IWGSLFAKANAVYNPIVYGISHPK 337 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,774 Number of Sequences: 438 Number of extensions: 3998 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -