BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0368 (407 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY279347-1|AAQ62844.1| 697|Homo sapiens zinc finger protein 434... 29 6.0 AY261676-1|AAP57398.1| 485|Homo sapiens zinc finger protein pro... 29 6.0 >AY279347-1|AAQ62844.1| 697|Homo sapiens zinc finger protein 434 protein. Length = 697 Score = 29.1 bits (62), Expect = 6.0 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +3 Query: 51 GKNLEQTPDQHQVDHGTYCSSRKSPAKDL*FXCCSQTV 164 G++ E+TP Q ++ H ++C+ K+ L CSQ+V Sbjct: 470 GESEEKTPSQEKMSHQSFCARDKACTHILCGKNCSQSV 507 >AY261676-1|AAP57398.1| 485|Homo sapiens zinc finger protein protein. Length = 485 Score = 29.1 bits (62), Expect = 6.0 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +3 Query: 51 GKNLEQTPDQHQVDHGTYCSSRKSPAKDL*FXCCSQTV 164 G++ E+TP Q ++ H ++C+ K+ L CSQ+V Sbjct: 258 GESEEKTPSQEKMSHQSFCARDKACTHILCGKNCSQSV 295 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 56,316,923 Number of Sequences: 237096 Number of extensions: 1077117 Number of successful extensions: 2248 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2248 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 3043111070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -