Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e40h0368
         (407 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF016665-2|AAC71181.1|  662|Caenorhabditis elegans Hypothetical ...    26   9.1  

>AF016665-2|AAC71181.1|  662|Caenorhabditis elegans Hypothetical
           protein C49D10.8 protein.
          Length = 662

 Score = 26.2 bits (55), Expect = 9.1
 Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 4/72 (5%)
 Frame = -1

Query: 314 TPMWSRYYNLFYTKRGKLQVISPSN*ASTVRFI*VVASK---LTGIRINRIGYYSLATTR 144
           T +  +++N++Y   G   ++   +   TV F  + A     L G+ + R+G+    TT+
Sbjct: 162 TKIAKKFHNVYYGILGLSSLVFYYSSPPTVAFNNMFARVWQFLIGMIVYRMGHDKKITTK 221

Query: 143 KLKIFRWGF-PG 111
            LKIF+  + PG
Sbjct: 222 SLKIFQEDYTPG 233


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,843,161
Number of Sequences: 27780
Number of extensions: 171217
Number of successful extensions: 355
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 351
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 355
length of database: 12,740,198
effective HSP length: 74
effective length of database: 10,684,478
effective search space used: 651753158
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)