BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0368 (407 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 1.8 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 21 4.1 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 7.1 DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse tr... 20 9.4 DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse tr... 20 9.4 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.6 bits (46), Expect = 1.8 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +1 Query: 31 EQQIERQGKI*SKHLISIRLTTGLTVVPGNPQRKIFNXRVVAKL 162 +QQ ++Q I L++I+ GL V+P K V A++ Sbjct: 1233 QQQTQQQPIILPSQLLNIKTLHGLKVIPTPAGLKTTGAAVYARV 1276 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.4 bits (43), Expect = 4.1 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -1 Query: 146 RKLKIFRWGFPGTTVSPVVNLM 81 +KL++ RWG TV+P + L+ Sbjct: 142 QKLRL-RWGTGAVTVNPELKLL 162 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 20.6 bits (41), Expect = 7.1 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -3 Query: 126 LGISWNYSKSRGQPDAD 76 +GI WN + R P +D Sbjct: 806 IGILWNMNNKRLDPKSD 822 >DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse transcriptase protein. Length = 127 Score = 20.2 bits (40), Expect = 9.4 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 182 INRIGYYSLATTRKLKIFRW 123 I R+ S T KLKI++W Sbjct: 77 IIRMFLISQQKTSKLKIYKW 96 >DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse transcriptase protein. Length = 110 Score = 20.2 bits (40), Expect = 9.4 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 182 INRIGYYSLATTRKLKIFRW 123 I R+ S T KLKI++W Sbjct: 60 IIRMFLISQQKTSKLKIYKW 79 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,708 Number of Sequences: 438 Number of extensions: 2119 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10256061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -