BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0367 (718 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3G6.11 |||ATP-dependent DNA helicase Chl1|Schizosaccharomyce... 32 0.094 SPCC1020.02 |spc7||kinetochore protein Spc7|Schizosaccharomyces ... 27 2.7 >SPAC3G6.11 |||ATP-dependent DNA helicase Chl1|Schizosaccharomyces pombe|chr 1|||Manual Length = 844 Score = 31.9 bits (69), Expect = 0.094 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -1 Query: 244 QNKKTENLEQDLIVTFENII-IIFEQTVVLFPKFVF 140 + K ENL +DL TF+N I II + VV FP F F Sbjct: 620 KRKDDENLLKDLGRTFQNFISIIPDGVVVFFPSFAF 655 >SPCC1020.02 |spc7||kinetochore protein Spc7|Schizosaccharomyces pombe|chr 3|||Manual Length = 1364 Score = 27.1 bits (57), Expect = 2.7 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -3 Query: 704 SNLPIKTAFIPNSTTGTLISNLMVGAGLHKVYRLQLQ 594 S+LP + + P G +SN V +GL K RL +Q Sbjct: 714 SSLPEEVSRQPTDDKGEQVSNADVDSGLSKTERLTIQ 750 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,148,143 Number of Sequences: 5004 Number of extensions: 69052 Number of successful extensions: 150 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 150 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -