BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0367 (718 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0947 + 22897552-22897614,22898291-22898513,22898599-228988... 29 4.9 11_03_0002 - 8850264-8850418,8850645-8851772,8851895-8852399 28 8.5 >08_02_0947 + 22897552-22897614,22898291-22898513,22898599-22898892, 22899346-22900598 Length = 610 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/44 (29%), Positives = 26/44 (59%) Frame = -1 Query: 250 GDQNKKTENLEQDLIVTFENIIIIFEQTVVLFPKFVFFSLRYIN 119 G +NK + + QDLI+ ++ + ++F +V P +V+ S+ N Sbjct: 16 GQKNKDKKGISQDLILAYKTLGVVF-GGLVTSPLYVYPSMNLTN 58 >11_03_0002 - 8850264-8850418,8850645-8851772,8851895-8852399 Length = 595 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +2 Query: 83 NCQGIISLSFLYIDISK*EKYKFWK*NNCLFKDYYY 190 NC + SF+ +D+ + E Y N LF +YY+ Sbjct: 206 NCSSTVEESFV-LDVKRGESYLLRVINTALFSEYYF 240 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,493,822 Number of Sequences: 37544 Number of extensions: 377767 Number of successful extensions: 667 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 647 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 667 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1862792824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -