Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e40h0367
         (718 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY121624-1|AAM51951.1|  151|Drosophila melanogaster GH18009p pro...    29   4.8  

>AY121624-1|AAM51951.1|  151|Drosophila melanogaster GH18009p
           protein.
          Length = 151

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 2/52 (3%)
 Frame = +3

Query: 132 SEKNTNFGNRTTVCSKIIIMFSNVTIRSCSRFS--VFLFWSPFICFTHLRSH 281
           S ++ + G   TV S      +  T+  C   S  +F FW  F CF  L+SH
Sbjct: 10  STESCSCGGLRTVDSTRATQTNRHTLACCMHLSYTLFFFWLFFFCFVCLQSH 61


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 32,257,600
Number of Sequences: 53049
Number of extensions: 685632
Number of successful extensions: 1312
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1287
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1312
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3190721655
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)