BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0354 (707 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 25 0.53 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 25 0.93 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 24 1.6 M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-... 23 2.8 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 5.0 AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding pr... 22 6.6 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 25.4 bits (53), Expect = 0.53 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +2 Query: 299 AEWSRELARVEDEIATLRTVL 361 +E R+L R+ED++ATLR L Sbjct: 559 SEKFRKLIRIEDDVATLRMKL 579 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 24.6 bits (51), Expect = 0.93 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 299 AEWSRELARVEDEIATLRTVL 361 +E R+L R+ED +ATLR L Sbjct: 612 SEKFRKLIRIEDNVATLRMKL 632 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 292 LVCLLGCEAGQLIGVCMSPATPV 224 L+CLL A +IGV ATPV Sbjct: 12 LICLLNETAKAIIGVDECQATPV 34 >M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E60. ). Length = 109 Score = 23.0 bits (47), Expect = 2.8 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +2 Query: 266 GLTPEQADQLRAEWSRELARVEDEIATLRTVLQSKIRQSSDLKRKLGI 409 G TPE+ A +LAR++ E A R + + R+ L R LG+ Sbjct: 15 GGTPEEKRPRTAFSGEQLARLKREFAENRYLTE---RRRQQLSRDLGL 59 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 22.2 bits (45), Expect = 5.0 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +1 Query: 229 EWQGTYILL*VGRPHTRAGRPVTR*MESRASPCRR 333 +W+ YIL + + TRA ++ S+ SP R+ Sbjct: 231 QWEEVYILQNLQKKRTRAEGRLSSDNMSKKSPVRK 265 >AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding protein protein. Length = 132 Score = 21.8 bits (44), Expect = 6.6 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +2 Query: 389 LKRKLGITVWKEITEDVNQGLKNVKESQVYQKTESVIK 502 + RK+G +V + N GL +K + ++ TE K Sbjct: 29 MTRKVGSSVSPVVELTENNGLYTLKTTSPFKNTEIKFK 66 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,961 Number of Sequences: 438 Number of extensions: 3442 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -