BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0351 (508 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK124803-1|BAC85953.1| 180|Homo sapiens protein ( Homo sapiens ... 30 5.3 >AK124803-1|BAC85953.1| 180|Homo sapiens protein ( Homo sapiens cDNA FLJ42813 fis, clone BRCAN2012355. ). Length = 180 Score = 29.9 bits (64), Expect = 5.3 Identities = 25/99 (25%), Positives = 45/99 (45%), Gaps = 2/99 (2%) Frame = -1 Query: 499 HSYCCNFIKKTCIFYFVSCFIYILSVV*FTSVCNYSNMKKKTNTYKNSLQHLRYYVYSIL 320 H+Y C I C++ ++ +IY +C + NM Y + + Y+Y++ Sbjct: 84 HTYMCAHIHM-CVYTYIYVYIYT-----HIHICVHINMYVSIYVYIYTCIQIYIYMYTLY 137 Query: 319 FSTYSVNSMYSNIL*FYIYT*II-SCI-*HMNYSSNIHL 209 TY+ Y +I I+T II C+ H+ NI++ Sbjct: 138 VCTYTYMCTYIHIC---IHTSIIYVCVYIHIQCPLNIYI 173 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 58,354,309 Number of Sequences: 237096 Number of extensions: 1021370 Number of successful extensions: 2474 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2431 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2474 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4706589866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -