BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0351 (508 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 24 0.79 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 23 1.8 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 23 1.8 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 23 2.4 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 23 2.4 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 23 2.4 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 23 2.4 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 23 2.4 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 23 2.4 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 23 2.4 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 2.4 AF134818-1|AAD40234.1| 130|Apis mellifera lambda crystallin-lik... 22 3.2 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 22 4.2 S76958-1|AAB33933.1| 90|Apis mellifera olfactory receptor prot... 21 7.3 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 7.3 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 9.7 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 9.7 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 24.2 bits (50), Expect = 0.79 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -1 Query: 403 CNYSNMKKKTNTYKNSLQHLRY 338 CNYSN N YK ++ Y Sbjct: 311 CNYSNNYYNNNNYKKLYYNINY 332 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.0 bits (47), Expect = 1.8 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = -1 Query: 397 YSNMKKKTNTYKNSLQHLRYYVYSILFSTYSVN 299 YSN N Y N+ + Y L+ Y +N Sbjct: 91 YSNYNNYNNNYNNNYNNNYNNNYKKLYKNYIIN 123 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.0 bits (47), Expect = 1.8 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = -1 Query: 397 YSNMKKKTNTYKNSLQHLRYYVYSILFSTYSVN 299 YSN N Y N+ + Y L+ Y +N Sbjct: 91 YSNYNNYNNNYNNNYNNNYNNNYKKLYKNYIIN 123 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 2.4 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -1 Query: 397 YSNMKKKTNTYKNSLQHLRYY 335 YSN N Y + + L+YY Sbjct: 91 YSNYNNYNNNYNTNYKKLQYY 111 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 2.4 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -1 Query: 397 YSNMKKKTNTYKNSLQHLRYY 335 YSN N Y + + L+YY Sbjct: 91 YSNYNNYNNNYNTNYKKLQYY 111 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 2.4 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -1 Query: 397 YSNMKKKTNTYKNSLQHLRYY 335 YSN N Y + + L+YY Sbjct: 91 YSNYNNYNNNYNTNYKKLQYY 111 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 2.4 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -1 Query: 397 YSNMKKKTNTYKNSLQHLRYY 335 YSN N Y + + L+YY Sbjct: 91 YSNYNNYNNNYNTNYKKLQYY 111 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 2.4 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -1 Query: 397 YSNMKKKTNTYKNSLQHLRYY 335 YSN N Y + + L+YY Sbjct: 91 YSNYNNYNNNYNTNYKKLQYY 111 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 2.4 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -1 Query: 397 YSNMKKKTNTYKNSLQHLRYY 335 YSN N Y + + L+YY Sbjct: 91 YSNYNNYNNNYNTNYKKLQYY 111 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 2.4 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -1 Query: 397 YSNMKKKTNTYKNSLQHLRYY 335 YSN N Y + + L+YY Sbjct: 91 YSNYNNYNNNYNTNYKKLQYY 111 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.6 bits (46), Expect = 2.4 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -1 Query: 400 NYSNMKKKTNTYKNSLQHLRYYV 332 NY+N N Y N+ + L Y + Sbjct: 333 NYNNYNNYNNNYNNNYKKLYYNI 355 >AF134818-1|AAD40234.1| 130|Apis mellifera lambda crystallin-like protein protein. Length = 130 Score = 22.2 bits (45), Expect = 3.2 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -1 Query: 400 NYSNMKKKTNTYKNSL 353 N MKK TYKNS+ Sbjct: 59 NAEGMKKYCETYKNSI 74 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.8 bits (44), Expect = 4.2 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -1 Query: 400 NYSNMKKKTNTYKNSLQHLRYYV 332 NYSN N Y N + L Y + Sbjct: 90 NYSNYNNYNNNYNNYNKKLYYNI 112 >S76958-1|AAB33933.1| 90|Apis mellifera olfactory receptor protein. Length = 90 Score = 21.0 bits (42), Expect = 7.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -2 Query: 129 VYFKLIIHISFLSNNVISNYF 67 + +II + F NVI +YF Sbjct: 18 IQIPVIIQLPFCGPNVIDHYF 38 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.0 bits (42), Expect = 7.3 Identities = 7/27 (25%), Positives = 14/27 (51%) Frame = -1 Query: 472 KTCIFYFVSCFIYILSVV*FTSVCNYS 392 K Y V CF+++ + + + NY+ Sbjct: 302 KAIDIYLVMCFVFVFAALLEYAAVNYT 328 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 20.6 bits (41), Expect = 9.7 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = -3 Query: 455 FCVVFYIYFVCSVI 414 FC++F ++F C I Sbjct: 453 FCLLFLMFFECIAI 466 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 20.6 bits (41), Expect = 9.7 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = -3 Query: 455 FCVVFYIYFVCSVI 414 FC++F ++F C I Sbjct: 506 FCLLFLMFFECIAI 519 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,345 Number of Sequences: 438 Number of extensions: 2686 Number of successful extensions: 17 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13986774 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -