SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e40h0348
         (666 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EU019710-1|ABU25222.1|  475|Tribolium castaneum dopa decarboxyla...    25   0.56 
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    22   3.9  
DQ414248-1|ABD63010.2|  311|Tribolium castaneum sloppy-paired pr...    21   9.1  

>EU019710-1|ABU25222.1|  475|Tribolium castaneum dopa decarboxylase
           protein.
          Length = 475

 Score = 25.0 bits (52), Expect = 0.56
 Identities = 9/31 (29%), Positives = 20/31 (64%)
 Frame = -1

Query: 666 KFRSRYKLLVDFLSGWRKSITQTKINPTRAP 574
           +F+   K ++D++SG+ ++I   ++ PT  P
Sbjct: 5   QFKDFAKEMIDYVSGYLENIRDRRVLPTVEP 35


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 22.2 bits (45), Expect = 3.9
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +1

Query: 535  GFIPYIRHCHNIR 573
            GF+ Y   CHNI+
Sbjct: 1675 GFLAYYEICHNIK 1687


>DQ414248-1|ABD63010.2|  311|Tribolium castaneum sloppy-paired
           protein.
          Length = 311

 Score = 21.0 bits (42), Expect = 9.1
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = +2

Query: 464 VLQDESSTSGSPQ 502
           VLQ  SSTS SP+
Sbjct: 281 VLQSPSSTSSSPE 293


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 161,999
Number of Sequences: 336
Number of extensions: 3818
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17281430
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -