BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0348 (666 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protei... 30 0.075 DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protei... 30 0.075 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 29 0.17 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 29 0.17 AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 26 0.93 AY330176-1|AAQ16282.1| 179|Anopheles gambiae odorant-binding pr... 24 5.0 AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 24 5.0 AY578802-1|AAT07307.1| 108|Anopheles gambiae FK506-binding prot... 23 6.5 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 23 6.5 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 23 8.7 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 23 8.7 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 23 8.7 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 23 8.7 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 23 8.7 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 23 8.7 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 23 8.7 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 23 8.7 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 23 8.7 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 23 8.7 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 23 8.7 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 23 8.7 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 23 8.7 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 23 8.7 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 23 8.7 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 23 8.7 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 23 8.7 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 23 8.7 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 23 8.7 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 23 8.7 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 23 8.7 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 23 8.7 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 23 8.7 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 23 8.7 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 23 8.7 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 23 8.7 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 23 8.7 AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding pr... 23 8.7 AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding pr... 23 8.7 >DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 29.9 bits (64), Expect = 0.075 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -1 Query: 588 PTRAPTNIVAMANIRYEPHDGKPYASIAYCG 496 P RAP NI + Y+P K Y YCG Sbjct: 161 PIRAPANIRSTVRWDYQPDICKDYKETGYCG 191 >DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 29.9 bits (64), Expect = 0.075 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -1 Query: 588 PTRAPTNIVAMANIRYEPHDGKPYASIAYCG 496 P RAP NI + Y+P K Y YCG Sbjct: 161 PIRAPANIRSTVRWDYQPDICKDYKETGYCG 191 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 28.7 bits (61), Expect = 0.17 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +3 Query: 486 LRGVHNMLWKHTAYHHGVHTLYSPLPQY 569 L H+ H AYH G+H Y P P + Sbjct: 179 LHPAHHPALLHPAYHTGLHHYYQPSPSH 206 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 28.7 bits (61), Expect = 0.17 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +3 Query: 486 LRGVHNMLWKHTAYHHGVHTLYSPLPQY 569 L H+ H AYH G+H Y P P + Sbjct: 179 LHPAHHPALLHPAYHTGLHHYYQPSPSH 206 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 26.2 bits (55), Expect = 0.93 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +2 Query: 140 MLEFYAPWCPACNALAP 190 +++F+A WC C +AP Sbjct: 24 VVDFFATWCGPCKVIAP 40 >AY330176-1|AAQ16282.1| 179|Anopheles gambiae odorant-binding protein AgamOBP49 protein. Length = 179 Score = 23.8 bits (49), Expect = 5.0 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 550 IRHCHNIRWCSSRIDFSLRD*LPP 621 ++HC + RW +S I +R +PP Sbjct: 154 LKHCPDDRWTASEICGKVRMGVPP 177 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 23.8 bits (49), Expect = 5.0 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = -2 Query: 542 MNPMMVSRMLP*HI--VDSPKCLTHL-EELSNQGHLQ*VRCLPSRDGIGLLPLFV 387 M P MV ML V + L HL + N H ++CL + D IGL +FV Sbjct: 58 MTPCMVIVMLSYIFGCVGNLMALIHLWRNVRNTKHALMLKCLLTNDLIGLSGMFV 112 >AY578802-1|AAT07307.1| 108|Anopheles gambiae FK506-binding protein protein. Length = 108 Score = 23.4 bits (48), Expect = 6.5 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -1 Query: 486 VLDSS*RTQQPRTFAVSQVPSIPGWDRFASTFCSRQRS 373 V DSS +P F+V + I GWD + QR+ Sbjct: 36 VFDSSRTRGKPFKFSVGKGEVIRGWDEGVAQMSVGQRA 73 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.4 bits (48), Expect = 6.5 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 Query: 137 WMLEFYAPWCPACNAL 184 W+ FYAP+ PA AL Sbjct: 453 WLGTFYAPFLPAIAAL 468 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 95 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 123 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 95 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 123 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 95 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 123 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 95 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 123 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 95 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 123 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 95 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 123 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 80 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 108 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 80 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 108 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 82 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 110 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 82 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 110 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 85 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 113 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 85 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 113 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 95 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 123 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 95 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 123 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 95 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 123 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 95 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 123 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 95 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 123 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 95 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 123 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 97 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 125 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 97 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 125 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 79 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 107 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 79 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 107 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 MLEFYAPWCPACNALAPVGRSSLHELPKTLSLY 238 ++ FYA WC AC A +S +L TL Y Sbjct: 94 IIMFYADWCFACMKAA----NSFKKLIDTLEPY 122 >AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding protein AgamOBP34 protein. Length = 311 Score = 23.0 bits (47), Expect = 8.7 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 433 GAFHPGMGSVCFHFLFSTKVSMDSTSRG 350 G F G S+CF + F T+ + S G Sbjct: 191 GCFPSGEESLCFFYSFVTRSGLYSVEDG 218 >AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding protein AgamOBP37 protein. Length = 311 Score = 23.0 bits (47), Expect = 8.7 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 433 GAFHPGMGSVCFHFLFSTKVSMDSTSRG 350 G F G S+CF + F T+ + S G Sbjct: 191 GCFPSGEESLCFFYSFVTRSGLYSVEDG 218 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 724,388 Number of Sequences: 2352 Number of extensions: 15187 Number of successful extensions: 92 Number of sequences better than 10.0: 63 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66486645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -