BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0342 (707 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42973| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) 29 4.9 >SB_42973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1864 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 9 LEDDDTSGSLRGLVQNVCAKCLPETCRTNTDVQHAS 116 LE D + LVQ +C LP T +++T+ H S Sbjct: 434 LEIRDGQDARAALVQRICGSALPATIKSSTESLHLS 469 >SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1327 Score = 28.7 bits (61), Expect = 4.9 Identities = 21/68 (30%), Positives = 34/68 (50%) Frame = +1 Query: 13 KMMTLPAVCGV*YKMYAPSAFRKLAGPTLTYNMRPRYKHPLLCREKLR*SI*RNIYMLKR 192 K++ AVC + Y+ + SA AG ++ +RP K PL R L +++K Sbjct: 613 KIILYHAVCALKYEHFHQSARIIYAGSSVPTRLRPS-KQPLCNRHHLASKQEEKTHIMKC 671 Query: 193 ILSIPTMA 216 I +I T+A Sbjct: 672 IYTICTLA 679 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,734,494 Number of Sequences: 59808 Number of extensions: 346721 Number of successful extensions: 1027 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 961 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1026 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -