BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0340 (574 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC117222-1|AAI17223.1| 832|Homo sapiens SIDT1 protein protein. 32 1.2 AK000181-1|BAA90994.1| 827|Homo sapiens protein ( Homo sapiens ... 32 1.2 >BC117222-1|AAI17223.1| 832|Homo sapiens SIDT1 protein protein. Length = 832 Score = 32.3 bits (70), Expect = 1.2 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +2 Query: 254 IITATQQKGVSSWELPLVLQ-TDDYFLMLNDMGRTLCPHDAGSD 382 ++ QQK V SW++PL+ Q ++ RTLCP +A ++ Sbjct: 94 LVVVRQQKEVLSWQVPLLFQGLYQRSYNYQEVSRTLCPSEATNE 137 >AK000181-1|BAA90994.1| 827|Homo sapiens protein ( Homo sapiens cDNA FLJ20174 fis, clone COL09863. ). Length = 827 Score = 32.3 bits (70), Expect = 1.2 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +2 Query: 254 IITATQQKGVSSWELPLVLQ-TDDYFLMLNDMGRTLCPHDAGSD 382 ++ QQK V SW++PL+ Q ++ RTLCP +A ++ Sbjct: 94 LVVVRQQKEVLSWQVPLLFQGLYQRSYNYQEVSRTLCPSEATNE 137 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,918,448 Number of Sequences: 237096 Number of extensions: 1868399 Number of successful extensions: 7155 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7046 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7155 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5872755824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -