BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0340 (574 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT023505-1|AAY84905.1| 1231|Drosophila melanogaster LD15018p pro... 28 7.8 AE014298-1282|AAF46448.3| 1231|Drosophila melanogaster CG7065-PA... 28 7.8 >BT023505-1|AAY84905.1| 1231|Drosophila melanogaster LD15018p protein. Length = 1231 Score = 28.3 bits (60), Expect = 7.8 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 2/64 (3%) Frame = +1 Query: 298 PVGATDRR--LLLDAKRHGQDFVPSRCRFRHKKRESSNCTADDVQ*R*RIRRHKTEEGRR 471 P+ AT + ++D D PSR R HK+R S + R +RR ++ RR Sbjct: 415 PIVATSKLPDAVIDISDDDVDSPPSRSRHSHKRRSISRSLSPKRGGRRAVRRSRSRSPRR 474 Query: 472 FLHR 483 +R Sbjct: 475 SYNR 478 >AE014298-1282|AAF46448.3| 1231|Drosophila melanogaster CG7065-PA protein. Length = 1231 Score = 28.3 bits (60), Expect = 7.8 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 2/64 (3%) Frame = +1 Query: 298 PVGATDRR--LLLDAKRHGQDFVPSRCRFRHKKRESSNCTADDVQ*R*RIRRHKTEEGRR 471 P+ AT + ++D D PSR R HK+R S + R +RR ++ RR Sbjct: 415 PIVATSKLPDAVIDISDDDVDSPPSRSRHSHKRRSISRSLSPKRGGRRAVRRSRSRSPRR 474 Query: 472 FLHR 483 +R Sbjct: 475 SYNR 478 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,658,766 Number of Sequences: 53049 Number of extensions: 559953 Number of successful extensions: 1422 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1422 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2255362491 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -