BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0336 (661 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC13C5.07 |rad32|mre11|Rad32 nuclease|Schizosaccharomyces pomb... 27 1.8 SPAPJ698.02c |rps002|rpsa-2, rps0-2, rps0|40S ribosomal protein ... 27 3.2 SPAC458.05 |pik3|vps34|phosphatidylinositol 3-kinase Pik3|Schizo... 25 7.3 SPAC1F3.07c |rsc58||RSC complex subunit Rsc58|Schizosaccharomyce... 25 7.3 SPAC23A1.12c |||phenylalanine-tRNA ligase beta subunit |Schizosa... 25 9.7 >SPAC13C5.07 |rad32|mre11|Rad32 nuclease|Schizosaccharomyces pombe|chr 1|||Manual Length = 649 Score = 27.5 bits (58), Expect = 1.8 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 3/49 (6%) Frame = +1 Query: 40 DYQSNLLIMSNDYGFNSDDSP---NKTNSHLQLPSPIITRRNRTASTSE 177 D+ S L S+++ + SP KTN +LPS + + RT S+ Sbjct: 552 DHHSPLATSSSEHEMEATPSPALLKKTNKRRELPSSLTKKNTRTPQRSK 600 >SPAPJ698.02c |rps002|rpsa-2, rps0-2, rps0|40S ribosomal protein S0B|Schizosaccharomyces pombe|chr 1|||Manual Length = 287 Score = 26.6 bits (56), Expect = 3.2 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 5/51 (9%) Frame = +2 Query: 335 ISTLPNPT*VRKISSCPCAHN-----SSHSGETRQVGRTTSVTIKNPRYVT 472 I+T+ NP V ISS P H ++H+G T GR T N Y+T Sbjct: 68 IATIENPADVCVISSRPYGHRAVLKFAAHTGATAIAGRFTPGNFTN--YIT 116 >SPAC458.05 |pik3|vps34|phosphatidylinositol 3-kinase Pik3|Schizosaccharomyces pombe|chr 1|||Manual Length = 801 Score = 25.4 bits (53), Expect = 7.3 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 13 LTYLLPILDDYQSNLLIMSNDYGFNSD 93 +TYLL + D + NLLI + + F++D Sbjct: 649 ITYLLGVGDRHLDNLLITKDGHFFHAD 675 >SPAC1F3.07c |rsc58||RSC complex subunit Rsc58|Schizosaccharomyces pombe|chr 1|||Manual Length = 403 Score = 25.4 bits (53), Expect = 7.3 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 46 QSNLLIMSNDYGFNSDDSPNKTNSHLQ 126 QSN + SN N SP+ TN LQ Sbjct: 367 QSNAALRSNSLSMNGSLSPSSTNVPLQ 393 >SPAC23A1.12c |||phenylalanine-tRNA ligase beta subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 589 Score = 25.0 bits (52), Expect = 9.7 Identities = 11/39 (28%), Positives = 23/39 (58%) Frame = +2 Query: 386 CAHNSSHSGETRQVGRTTSVTIKNPRYVTFFVLMQGLLP 502 C+H+ +++ R+ + +V + NP+ + F V+ LLP Sbjct: 408 CSHDENYAW-LRKTDDSKAVQLANPKTLEFQVVRSSLLP 445 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,829,625 Number of Sequences: 5004 Number of extensions: 62783 Number of successful extensions: 191 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 185 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 191 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 299817502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -