BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0336 (661 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 25 2.1 CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 24 3.7 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 25.0 bits (52), Expect = 2.1 Identities = 16/59 (27%), Positives = 27/59 (45%) Frame = +1 Query: 40 DYQSNLLIMSNDYGFNSDDSPNKTNSHLQLPSPIITRRNRTASTSERALGNPLETGKIK 216 DY+ L + +N +D N + LPS + RN SE+ NP++ +I+ Sbjct: 1209 DYELRLRVCANYIPELTDSQSNMALIEVTLPSGYVVDRN---PISEQTTVNPIQNMEIR 1264 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 24.2 bits (50), Expect = 3.7 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = -2 Query: 585 FIMIVHKTVNTHTLHSYIQVYKIRRVFDGKRPCIKTKKVTYLG 457 FI + KTV H S Y + FDG + K+V LG Sbjct: 409 FIYAIDKTVRLHAQRSSAPTYYYQFSFDGDLNLV--KRVLMLG 449 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 690,439 Number of Sequences: 2352 Number of extensions: 15176 Number of successful extensions: 121 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 121 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65650335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -