BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0336 (661 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 24 1.5 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 4.5 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 23.8 bits (49), Expect = 1.5 Identities = 18/67 (26%), Positives = 30/67 (44%) Frame = -3 Query: 449 LLQRWFVPLDVFLRSEMNYAHMDSLKFFELRWDWAKSIYNFITRQGYIFTFDIRYMEKYI 270 L RW + VF ++ H D+ F + + S+Y+ R+ T D + +KY Sbjct: 163 LRTRWSISGTVFDLINIHLFH-DASNFIAM--ETFPSVYSKTRRRALEHTLDRFHNDKYS 219 Query: 269 FAPFFGF 249 P+F F Sbjct: 220 NVPYFLF 226 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -1 Query: 178 FLMSTLFDFAE 146 FLM ++FDFAE Sbjct: 315 FLMDSMFDFAE 325 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,914 Number of Sequences: 438 Number of extensions: 4432 Number of successful extensions: 26 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19855845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -