Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e40h0336
         (661 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.     24   1.5  
AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    22   4.5  

>AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.
          Length = 388

 Score = 23.8 bits (49), Expect = 1.5
 Identities = 18/67 (26%), Positives = 30/67 (44%)
 Frame = -3

Query: 449 LLQRWFVPLDVFLRSEMNYAHMDSLKFFELRWDWAKSIYNFITRQGYIFTFDIRYMEKYI 270
           L  RW +   VF    ++  H D+  F  +  +   S+Y+   R+    T D  + +KY 
Sbjct: 163 LRTRWSISGTVFDLINIHLFH-DASNFIAM--ETFPSVYSKTRRRALEHTLDRFHNDKYS 219

Query: 269 FAPFFGF 249
             P+F F
Sbjct: 220 NVPYFLF 226


>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = -1

Query: 178 FLMSTLFDFAE 146
           FLM ++FDFAE
Sbjct: 315 FLMDSMFDFAE 325


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 188,914
Number of Sequences: 438
Number of extensions: 4432
Number of successful extensions: 26
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 26
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 19855845
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)