BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0327 (678 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 25 0.75 AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical pro... 23 1.7 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 23 3.0 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 23 3.0 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 22 5.3 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 9.3 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 24.6 bits (51), Expect = 0.75 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 430 ESLPSAGGRAARGVYCVYRALRRCDS 507 E LP+A G+A+ G C LR C S Sbjct: 175 EDLPAAAGKASNGNKCC--CLRTCSS 198 >AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical protein protein. Length = 148 Score = 23.4 bits (48), Expect = 1.7 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -2 Query: 512 CGESHLRKARYTQ 474 C S LRKARYT+ Sbjct: 62 CSNSPLRKARYTE 74 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +3 Query: 33 RQAIELNPPHLSWYQLTIEPNTLFGS 110 R E PP + +Y T+E T+ G+ Sbjct: 110 RACREGEPPRICYYHFTLELYTVLGA 135 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +3 Query: 33 RQAIELNPPHLSWYQLTIEPNTLFGS 110 R E PP + +Y T+E T+ G+ Sbjct: 110 RACREGEPPRICYYHFTLELYTVLGA 135 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -1 Query: 318 PSGKVTLPCAPQPIPM*SP 262 P +P AP+P P+ SP Sbjct: 80 PEPDPEIPVAPEPAPLASP 98 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.0 bits (42), Expect = 9.3 Identities = 13/47 (27%), Positives = 18/47 (38%) Frame = +3 Query: 57 PHLSWYQLTIEPNTLFGSRPPVLPDDDALWDIFEQGHQLLTAAGYQQ 197 P+ SW T+ T G +A WD+ G L + G Q Sbjct: 161 PYESWPFNTMSGATHHGGIKSDSVTSNAWWDVHSTGSWLDMSGGMHQ 207 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,540 Number of Sequences: 336 Number of extensions: 4060 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17697850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -