BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0327 (678 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC11C11.01 ||SPBC17D1.08|RNA-binding protein|Schizosaccharomyc... 27 3.3 SPAC1420.04c |cox1101|cox11, SPAPB17E12.01c, cox11|fusion cytoch... 27 3.3 SPAC19B12.13 |cox1102|cox11, cox11-b, cox11, SPAPB8E5.01|fusion ... 27 3.3 SPAC2G11.02 |urb2||ribosome biogenesis protein Urb2 |Schizosacch... 26 4.4 SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces pom... 26 5.8 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 25 7.6 >SPBC11C11.01 ||SPBC17D1.08|RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 493 Score = 26.6 bits (56), Expect = 3.3 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = +2 Query: 314 DGRILRTTKTRHPRGFMQGRYLESQRDV--EATDK 412 DGR++ T T HP+ +LES E+ DK Sbjct: 199 DGRLISATITNHPKRLPNAEHLESSTKTKDESQDK 233 >SPAC1420.04c |cox1101|cox11, SPAPB17E12.01c, cox11|fusion cytochrome c oxidase assembly protein Cox1101, mitochondrial ribosomal protein Rsm22|Schizosaccharomyces pombe|chr 1|||Manual Length = 753 Score = 26.6 bits (56), Expect = 3.3 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -1 Query: 198 IADNPL--RLITDAPVRIYPTTRHRPAAPVVANQ 103 + +NP ++I D IYP+T P +PV N+ Sbjct: 204 VEENPFLKKIIYDIHHNIYPSTSPNPTSPVTLNR 237 >SPAC19B12.13 |cox1102|cox11, cox11-b, cox11, SPAPB8E5.01|fusion cytochrome c oxidase assembly protein Cox1102, mitochondrial ribosomal protein Rsm2202|Schizosaccharomyces pombe|chr 1|||Manual Length = 753 Score = 26.6 bits (56), Expect = 3.3 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -1 Query: 198 IADNPL--RLITDAPVRIYPTTRHRPAAPVVANQ 103 + +NP ++I D IYP+T P +PV N+ Sbjct: 204 VEENPFLKKIIYDIHHNIYPSTSPNPTSPVTLNR 237 >SPAC2G11.02 |urb2||ribosome biogenesis protein Urb2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1318 Score = 26.2 bits (55), Expect = 4.4 Identities = 14/62 (22%), Positives = 30/62 (48%) Frame = -3 Query: 673 HVGWIRRSRRIRQYKFTQPEKAPAANLKTVSHVPLSASNPQIR*DNPGQSPRLTVANHIF 494 H +++ + I F +P+K P +++ + + NP + D+ ++ LT A +F Sbjct: 1180 HDSEMKKIKGIALMNFYKPKKVPIHVVQSFCRLLTTWMNPNLMHDSNKKNSSLTDAERLF 1239 Query: 493 AK 488 K Sbjct: 1240 VK 1241 >SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1375 Score = 25.8 bits (54), Expect = 5.8 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -3 Query: 676 PHVGWIRRSRRIRQYKFTQPEKAPAANLKTVSHVPLS 566 P V W+ S ++ Y FTQ + + A NL + V L+ Sbjct: 61 PVVFWVDGSEKLHAYSFTQRKISLAKNLIPLFSVDLN 97 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 25.4 bits (53), Expect = 7.6 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +3 Query: 81 TIEPNTLFGSRPPVLPDDDALWDIFEQGHQLLTAA 185 T + +T + P P+ A+WD+F++ + T + Sbjct: 443 TRKTSTPVSNNRPTTPEQQAVWDVFQRIYTRFTGS 477 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,067,635 Number of Sequences: 5004 Number of extensions: 65712 Number of successful extensions: 154 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 154 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 311890690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -