BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0327 (678 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z22179-2|CAA80168.1| 159|Caenorhabditis elegans Hypothetical pr... 31 0.76 Z75951-1|CAB00091.2| 408|Caenorhabditis elegans Hypothetical pr... 30 1.3 U88181-2|AAB42303.1| 491|Caenorhabditis elegans Dnaj domain (pr... 28 7.0 Z83226-4|CAI79261.2| 206|Caenorhabditis elegans Hypothetical pr... 27 9.3 Z83219-3|CAD57687.1| 965|Caenorhabditis elegans Hypothetical pr... 27 9.3 AL117204-16|CAB55130.1| 389|Caenorhabditis elegans Hypothetical... 27 9.3 >Z22179-2|CAA80168.1| 159|Caenorhabditis elegans Hypothetical protein F58A4.2 protein. Length = 159 Score = 31.1 bits (67), Expect = 0.76 Identities = 21/69 (30%), Positives = 32/69 (46%) Frame = -3 Query: 667 GWIRRSRRIRQYKFTQPEKAPAANLKTVSHVPLSASNPQIR*DNPGQSPRLTVANHIFAK 488 G++ R R + F +K P +++ V L S P P QS + +IF Sbjct: 76 GFVERKNRAASFDFCLSDK-PQSDV-VVHRRSLQPSTP-----TPNQSAESSFIENIFDS 128 Query: 487 PGIRNKLHA 461 PG RN+LH+ Sbjct: 129 PGQRNRLHS 137 >Z75951-1|CAB00091.2| 408|Caenorhabditis elegans Hypothetical protein F14A5.1 protein. Length = 408 Score = 30.3 bits (65), Expect = 1.3 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -2 Query: 635 IQVYSARKSSSSEF-KNSFPCSVICQ*SANSVR*PWAIASSNCGESHLRKARYTQ*T 468 ++VY+ K+ +S F KNS PC V CQ SA S R + I S S R+ Q T Sbjct: 40 LKVYNYIKTKASNFTKNSEPCQV-CQDSA-STRHHFGITSCTACASFFRRTTMNQFT 94 >U88181-2|AAB42303.1| 491|Caenorhabditis elegans Dnaj domain (prokaryotic heat shockprotein) protein 7 protein. Length = 491 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 9 LEEALGDLRQAIELNPPHLSWY 74 LEE+L +R+ ++LNP H S Y Sbjct: 224 LEESLNVIRECLKLNPDHKSCY 245 >Z83226-4|CAI79261.2| 206|Caenorhabditis elegans Hypothetical protein F43D2.6 protein. Length = 206 Score = 27.5 bits (58), Expect = 9.3 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -3 Query: 469 LHARRGLQQTEAIHKE--LKRLICGFDITLAFQIPSLH 362 LH RR QQ E++H + + CGF I + + S H Sbjct: 117 LHRRRNPQQYESVHNDNGWYPICCGFGIPMGTVVFSTH 154 >Z83219-3|CAD57687.1| 965|Caenorhabditis elegans Hypothetical protein C31C9.6 protein. Length = 965 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 54 PPHLSWYQLTIEPNTLFGSRPPVLPDDDALWDIFEQGH 167 PPH Y+ T +P+T+ PP + + L I E H Sbjct: 677 PPHWDSYRWTTKPDTVPKQTPPPTHNSNVLPHIDENDH 714 >AL117204-16|CAB55130.1| 389|Caenorhabditis elegans Hypothetical protein Y116A8C.25 protein. Length = 389 Score = 27.5 bits (58), Expect = 9.3 Identities = 14/41 (34%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 510 WRITSSQ-SPVYAINSTRGAASSRRKRFIKNSNGLSVASTS 391 W + SQ + ++A N + A ++RR RF+ ++G+S S S Sbjct: 85 WALAGSQLAKMHAKNGEQLAQNARRTRFVSVNSGMSDISKS 125 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,237,308 Number of Sequences: 27780 Number of extensions: 381875 Number of successful extensions: 978 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 951 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 978 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1539654388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -