BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0323 (660 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 22 3.9 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 3.9 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 22 5.1 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 6.8 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 9.0 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 9.0 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 9.0 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 9.0 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 22.2 bits (45), Expect = 3.9 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 269 LSFVQSATLVLYCSSVRSLVSRFCLPLSKRR 177 L F+ + TL++ C VRS S+ K R Sbjct: 245 LIFLFNCTLIIMCDCVRSEASKVVKNAQKLR 275 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.2 bits (45), Expect = 3.9 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 602 RKTPSPGLPVKSCRPSPPDQ 543 RK PG+P+ S S PD+ Sbjct: 828 RKMEPPGVPLNSTPRSTPDK 847 Score = 22.2 bits (45), Expect = 3.9 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -2 Query: 608 RGRKTPSPGLPVKSCRPSPPDQCDGMYST 522 +G + S G+P+K PP G ST Sbjct: 1095 QGSSSSSEGVPLKGTAVPPPSGSSGPGST 1123 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +2 Query: 521 LWSTFHRTDLVETACRISLADLGLEFFDLFLIH 619 +W ++ RT + T + L + FF F++H Sbjct: 123 IWKSYKRTQIFITCELFFVILLWISFFLNFMLH 155 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = -2 Query: 275 FQLSFVQSATLVLYCSSVRSLVSRFCL 195 + LS + L+ +C+ V L +FC+ Sbjct: 171 YTLSKMSQVMLIQFCAFVVVLKQKFCV 197 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -3 Query: 646 LPSFKRHWIVDEE 608 LP+F R W +D+E Sbjct: 297 LPTFGRAWAMDDE 309 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.0 bits (42), Expect = 9.0 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -3 Query: 328 GMNVPSRSFKVATSFTLPFSLASF 257 G PS+ V+ S ++P +ASF Sbjct: 1289 GEGQPSKKVTVSPSASVPAKIASF 1312 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -1 Query: 240 LILFICEVSRVSFLF 196 L++F C+ V FLF Sbjct: 72 LVIFYCQEGSVDFLF 86 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -1 Query: 240 LILFICEVSRVSFLF 196 L++F C+ V FLF Sbjct: 305 LVIFYCQEGSVDFLF 319 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -1 Query: 240 LILFICEVSRVSFLF 196 L++F C+ V FLF Sbjct: 305 LVIFYCQEGSVDFLF 319 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,148 Number of Sequences: 336 Number of extensions: 3300 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -