BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0320 (440 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) 122 2e-28 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_52510| Best HMM Match : RRM_1 (HMM E-Value=8.1e-21) 47 8e-06 SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) 44 7e-05 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_20581| Best HMM Match : RRM_1 (HMM E-Value=1.7e-07) 42 3e-04 SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) 39 0.002 SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) 39 0.002 SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) 38 0.003 SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) 37 0.008 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) 35 0.034 SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) 34 0.045 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.045 SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18) 34 0.060 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 33 0.079 SB_13046| Best HMM Match : La (HMM E-Value=5e-23) 33 0.079 SB_19711| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.10 SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) 33 0.10 SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) 32 0.24 SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.32 SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) 31 0.42 SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.56 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.56 SB_42066| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.56 SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.56 SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.74 SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.74 SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24) 29 1.3 SB_8144| Best HMM Match : VWA (HMM E-Value=3.1e-16) 29 1.3 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_28070| Best HMM Match : RRM_1 (HMM E-Value=1.3e-07) 29 1.7 SB_17438| Best HMM Match : Alpha_L_fucos (HMM E-Value=1.1e-28) 29 1.7 SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) 29 2.2 SB_20454| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_47196| Best HMM Match : Extensin_2 (HMM E-Value=0.02) 28 3.9 SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) 28 3.9 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 27 5.2 SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) 27 6.9 SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) 27 6.9 SB_56972| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 27 9.1 SB_19823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 27 9.1 SB_8753| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 >SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 122 bits (293), Expect = 2e-28 Identities = 60/106 (56%), Positives = 70/106 (66%) Frame = +2 Query: 74 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 R PP IDGM SLKVDNLTYRTT EDL++VF++ G++GDIYIPRDR T ESRGFAFVRF+E Sbjct: 7 RGPPEIDGMTSLKVDNLTYRTTVEDLKQVFKKYGDLGDIYIPRDRNTHESRGFAFVRFYE 66 Query: 254 LVTLKKPWTRWTDECWTAGNFAFRWRDMVAPHRHTGVVTIAGXVQV 391 + C A F FRWRDMV P G + V+V Sbjct: 67 KRDAEDAMDCMDATCLMAEKFVFRWRDMVVPRIPIGRGVLVVMVEV 112 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 51.6 bits (118), Expect = 3e-07 Identities = 25/47 (53%), Positives = 31/47 (65%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 V NL Y T DL +VFER G+V + I RD+ TRESRG AF+ F + Sbjct: 14 VGNLPYSLTNSDLHKVFERYGKVVKVTILRDKETRESRGVAFILFID 60 >SB_52510| Best HMM Match : RRM_1 (HMM E-Value=8.1e-21) Length = 304 Score = 46.8 bits (106), Expect = 8e-06 Identities = 17/48 (35%), Positives = 32/48 (66%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 +++V NL+ T DL+ +F G + I++ +D++T +S+GFAF+ F Sbjct: 182 TIRVTNLSEETRESDLQELFRPLGPISRIFLAKDKFTNQSKGFAFINF 229 >SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) Length = 328 Score = 43.6 bits (98), Expect = 7e-05 Identities = 22/52 (42%), Positives = 29/52 (55%) Frame = +2 Query: 92 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 D + L V L+Y TT E L+ F + GE+ + I D T RGFAFV+F Sbjct: 26 DDIGKLFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRGFAFVQF 77 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 43.2 bits (97), Expect = 1e-04 Identities = 25/56 (44%), Positives = 32/56 (57%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVTLKK 271 SL V NL+Y TT + L FE C I+ DR + ESRGF FV + ++ T KK Sbjct: 290 SLIVRNLSYDTTTDSLGAAFEGCSNAKVIF---DRESGESRGFGFVDYDDVETAKK 342 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 42.7 bits (96), Expect = 1e-04 Identities = 22/52 (42%), Positives = 28/52 (53%) Frame = +2 Query: 92 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 D L V L TT E LR FE GE+ D+ + D T++SRGF +V F Sbjct: 11 DPRAKLFVGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTF 62 >SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 41.5 bits (93), Expect = 3e-04 Identities = 21/47 (44%), Positives = 26/47 (55%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L V L Y TT +++ F R GE+ + D TR SRGF FVRF Sbjct: 117 LIVLGLPYATTESEMKEYFTRFGEIDFCEVKLDPNTRRSRGFGFVRF 163 Score = 32.3 bits (70), Expect = 0.18 Identities = 22/65 (33%), Positives = 30/65 (46%) Frame = +2 Query: 53 LLKMSYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 232 L ++ RP ++ L V L TT + L F + GEV D+YIP + R F Sbjct: 183 LCEVRLPRPKEELNVPKKLFVGRLPESTTEKTLMEYFAQFGEVTDVYIP-----KPFRHF 237 Query: 233 AFVRF 247 FV F Sbjct: 238 GFVTF 242 >SB_20581| Best HMM Match : RRM_1 (HMM E-Value=1.7e-07) Length = 97 Score = 41.5 bits (93), Expect = 3e-04 Identities = 15/39 (38%), Positives = 27/39 (69%) Frame = +2 Query: 131 RTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 R ED+R FE+ G + D+++ +D+ T+E+RG +V+F Sbjct: 33 RHNAEDIRSAFEQYGTIEDVWVVKDKATKENRGVCYVKF 71 >SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 781 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/40 (42%), Positives = 26/40 (65%) Frame = +2 Query: 143 EDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVT 262 EDLR FE G++ + I RD TRE++G+ +V+F + T Sbjct: 67 EDLRSKFESFGDIEYVQIVRDHKTRENKGYGYVKFHKSST 106 >SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) Length = 842 Score = 39.1 bits (87), Expect = 0.002 Identities = 23/65 (35%), Positives = 35/65 (53%) Frame = +2 Query: 53 LLKMSYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 232 +L + YG + L V LT + + E LR+ FE+ GE+ + + RD T+ SRGF Sbjct: 95 ILDIDYGTS--HFSSTLELSVIPLT-QASAEGLRQHFEKFGELKECVVMRDPVTKRSRGF 151 Query: 233 AFVRF 247 F+ F Sbjct: 152 GFLTF 156 >SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) Length = 407 Score = 38.7 bits (86), Expect = 0.002 Identities = 19/52 (36%), Positives = 27/52 (51%) Frame = +2 Query: 92 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 D S+ + NL + E LR +F CG V + + RDR T +GF +V F Sbjct: 53 DHQRSVFIGNLPFDIEEEPLRELFTTCGNVESVRLIRDRKTGIGKGFGYVLF 104 >SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 514 Score = 38.3 bits (85), Expect = 0.003 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +2 Query: 140 PEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 P DL F + G+V D+ I DR +R S+G A++ F Sbjct: 159 PRDLEEFFSKVGQVSDVRIISDRNSRRSKGIAYIEF 194 Score = 35.5 bits (78), Expect = 0.020 Identities = 19/59 (32%), Positives = 29/59 (49%) Frame = +2 Query: 95 GMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVTLKK 271 G L V +L + T ++ VFE G V + + D T S+G+ FV+F E K+ Sbjct: 240 GPTRLYVGSLHFNITEAMVKAVFEPFGTVDSVQLIYDSETNRSKGYGFVQFREAEAAKR 298 >SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) Length = 291 Score = 36.7 bits (81), Expect = 0.008 Identities = 15/45 (33%), Positives = 28/45 (62%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 L V + Y + + LR+ F + GE+ + + +DR T++S+G+ FV Sbjct: 12 LFVGGIPYESGDDALRKFFAQFGEIREAVVIKDRVTKKSKGYGFV 56 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 35.5 bits (78), Expect = 0.020 Identities = 18/45 (40%), Positives = 26/45 (57%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 + NL ++ DL+ F R +V D+ + DR T+ RGFAFV F Sbjct: 234 IGNLDFKVNEADLQDRFSRY-DVVDVQVISDRETQRPRGFAFVTF 277 Score = 27.1 bits (57), Expect = 6.9 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +1 Query: 256 RDAEEALDTMDGRMLDGRELRVQMA 330 ++ E+A++ +DG+ DGR ++V A Sbjct: 281 KNMEDAINELDGQEFDGRSMKVNQA 305 >SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 420 Score = 34.7 bits (76), Expect = 0.034 Identities = 20/56 (35%), Positives = 30/56 (53%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVTLKK 271 +L VDNL+ T D+ R F G+V ++I DR T +S+G V+ T+ K Sbjct: 320 TLFVDNLSEDTKELDVLRYFRPYGQVAKVHILTDRETGKSKGCGVVKLRHPGTVNK 375 Score = 31.9 bits (69), Expect = 0.24 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVR 244 L V +L + TT ++LR FE+CGE+ I + + R F R Sbjct: 238 LMVQDLDFDTTVDELREYFEKCGELTGIDLLINSEKRTCAAIVFFR 283 Score = 27.5 bits (58), Expect = 5.2 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 S+ V L T E L+ FE+ GEV + I R + SR + FV F Sbjct: 81 SVFVGGLASGTDEEGLKDYFEQFGEVESVRIMR-TFLGYSRNYGFVLF 127 >SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) Length = 1313 Score = 34.3 bits (75), Expect = 0.045 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 L V +LT + ++ +F G V + +P DR SRGFA+V + + Sbjct: 1159 LYVAHLTRNVNKDHVQEIFSVYGRVKTVDLPTDRTNNLSRGFAYVEYVD 1207 Score = 27.5 bits (58), Expect = 5.2 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 259 DAEEALDTMDGRMLDGRELRVQ 324 + E+AL MDG +DG+E+ VQ Sbjct: 1210 ECEKALKHMDGGQIDGQEIAVQ 1231 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 34.3 bits (75), Expect = 0.045 Identities = 16/52 (30%), Positives = 29/52 (55%) Frame = +2 Query: 92 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 D +L ++ + + ED++++F G V + RDR T +S G+AFV + Sbjct: 24 DERTNLIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNY 75 >SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18) Length = 209 Score = 33.9 bits (74), Expect = 0.060 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +2 Query: 134 TTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 TT EDL +F R G + + RD+ T ES +AF+ F Sbjct: 131 TTDEDLEIIFSRFGTILSCEVIRDQKTGESLQYAFIEF 168 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 33.5 bits (73), Expect = 0.079 Identities = 21/51 (41%), Positives = 29/51 (56%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFEL 256 +L V N+ TT DL+ FER GEV D+ I + + +AFV+F EL Sbjct: 250 TLFVGNIEKTTTYGDLKEAFERYGEVIDVDIKKQ---PGNNPYAFVQFAEL 297 >SB_13046| Best HMM Match : La (HMM E-Value=5e-23) Length = 442 Score = 33.5 bits (73), Expect = 0.079 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = +2 Query: 116 DNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 + L + + L++VF G+V + +PR ++ E +GFAF+ F Sbjct: 93 EKLPFHADHDWLKKVFSEFGKVLYVSLPRFKHNGEIKGFAFIEF 136 >SB_19711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 33.1 bits (72), Expect = 0.10 Identities = 20/57 (35%), Positives = 28/57 (49%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVTLKKPW 277 L + NL +DL+ + + G V I RD +S G A VRFF +L+ PW Sbjct: 121 LIIQNLPKGIQEKDLKELLQLYGNVLVCNIERDS-NGDSSGSALVRFFRATSLQIPW 176 >SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 1026 Score = 33.1 bits (72), Expect = 0.10 Identities = 13/56 (23%), Positives = 34/56 (60%) Frame = +2 Query: 80 PPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 P + +++ + NL++ +T +++ +F++ G++ + D T+ S+G AFV++ Sbjct: 409 PSDVKEGLTVFIRNLSFDSTQKNITNLFKQFGDIAYCKVVVDHLTQHSKGSAFVKY 464 >SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) Length = 298 Score = 31.9 bits (69), Expect = 0.24 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L + L F G++ D+ IP D T + RGF FV F Sbjct: 9 VGGLAEEVDEKVLHAAFIPFGDITDVQIPMDYTTSKHRGFGFVEF 53 >SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 381 Score = 31.5 bits (68), Expect = 0.32 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +2 Query: 143 EDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVTLKKPWTRWTDE 295 ++L + E+CGE+ + + D T ++GFAF F E + + T D+ Sbjct: 167 DELIPLLEKCGEIREFRLQMDPATGLNKGFAFCTFTEQTSAYQAITTLNDK 217 >SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) Length = 171 Score = 31.1 bits (67), Expect = 0.42 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = +2 Query: 146 DLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 ++++ FE+ G V I + R + + S+G+AFV F Sbjct: 113 EIKKFFEQFGTVNRIRLSRSKKSARSKGYAFVEF 146 >SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 30.7 bits (66), Expect = 0.56 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 256 RDAEEALDTMDGRMLDGRELRVQMA 330 RDAE+A+ +DGR + G+ +RV++A Sbjct: 79 RDAEDAVRELDGRYICGQRVRVELA 103 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 30.7 bits (66), Expect = 0.56 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 L + NL + + ++ + FE G V + I RD+ + SRGF FV Sbjct: 11 LYIGNLNFNSDEGEIEQAFEEFG-VEKVDILRDKESGRSRGFGFV 54 >SB_42066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 30.7 bits (66), Expect = 0.56 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = +2 Query: 101 VSLKVDNLTYR--TTPEDLRRVFERCGEVGDI-YIPRDR 208 +S+K +N R T E+L +FE CG+V D ++P+DR Sbjct: 147 LSVKYNNDKTRESVTEEELTSMFEDCGDVADFRFLPKDR 185 >SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 30.7 bits (66), Expect = 0.56 Identities = 14/53 (26%), Positives = 29/53 (54%) Frame = +2 Query: 89 IDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 ++G + L V N+ +D+ +F GE+ ++++ DR T +G+A V + Sbjct: 290 VEGWI-LFVTNIHEEAQEDDIHELFSDYGEIKNLHVNLDRRTGFIKGYALVEY 341 >SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 30.3 bits (65), Expect = 0.74 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 +L V N+ Y E + +F +CG V + I D ++ +GF FV Sbjct: 276 TLYVYNIGYDANQEGITALFGQCGIVNKVDIMWDWQRQQCKGFCFV 321 >SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 783 Score = 30.3 bits (65), Expect = 0.74 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 2/75 (2%) Frame = +2 Query: 80 PPRIDGMVS--LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 PP D + L V NL + +DLR FE+ G V D+ I R + +AFV+F + Sbjct: 228 PPEEDPKATRTLFVGNLETGISCQDLRLSFEKFGVVLDVDIKRPA-RGQGNTYAFVKFAD 286 Query: 254 LVTLKKPWTRWTDEC 298 L K +C Sbjct: 287 LDVAAKAKCAMQGQC 301 >SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 29.9 bits (64), Expect = 0.97 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +1 Query: 256 RDAEEALDTMDGRMLDGRELRVQMA 330 RDAE+A+ +DGR + G+ RV++A Sbjct: 49 RDAEDAVRELDGRYICGQRARVELA 73 >SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24) Length = 343 Score = 29.5 bits (63), Expect = 1.3 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 161 FERCGEVGDIYIPRDRYTRESRGFAFVRF 247 F GE+ +YIP + T+E +G V F Sbjct: 141 FSSSGEIASVYIPENLKTKERKGHCIVTF 169 >SB_8144| Best HMM Match : VWA (HMM E-Value=3.1e-16) Length = 193 Score = 29.5 bits (63), Expect = 1.3 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = -2 Query: 376 CDRNDSCMAMRGDHIAPSEREVP--CRPTFVRPSCP 275 C+ +D C G+ P E E P CR T + SCP Sbjct: 27 CNSDDKCSP--GERCRPQENECPLKCRKTIKKKSCP 60 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 29.1 bits (62), Expect = 1.7 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 143 EDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 ++L VFE CG + D + D + ++GFAF F Sbjct: 166 DELIPVFEECGHIYDFRLMIDPISGLTKGFAFCTF 200 >SB_28070| Best HMM Match : RRM_1 (HMM E-Value=1.3e-07) Length = 694 Score = 29.1 bits (62), Expect = 1.7 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRE 220 L V L+ TT DLR VFE+ G V I I D +E Sbjct: 183 LGVFGLSLYTTERDLRPVFEKYGPVEAIQIVYDHQAKE 220 >SB_17438| Best HMM Match : Alpha_L_fucos (HMM E-Value=1.1e-28) Length = 261 Score = 29.1 bits (62), Expect = 1.7 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +2 Query: 242 RFFELVTLKKPWTRWTDECWTAGNFAFRWRDMVA 343 + ++L+ +P WTD W A N FR R+ +A Sbjct: 6 QMYDLINTYEPSYLWTDGDWVAPNEYFRSREFLA 39 >SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) Length = 255 Score = 28.7 bits (61), Expect = 2.2 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +2 Query: 71 GRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESR 226 G R V L V + +DLR +FE G++ ++ I +D+YT + + Sbjct: 160 GTTSVRDSNSVKLFVGQVPRTWEEKDLRPIFEPYGQIYELTILKDKYTGQHK 211 >SB_20454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 693 Score = 27.9 bits (59), Expect = 3.9 Identities = 17/58 (29%), Positives = 26/58 (44%) Frame = +2 Query: 56 LKMSYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRG 229 LK + GR P D + + D+ + DLR RCG +P D+ R ++G Sbjct: 485 LKQTGGRIPENKDSLGRDRRDSCGTKEL-RDLRDAIRRCGVTDSPTVPDDKGKRNAKG 541 >SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4924 Score = 27.9 bits (59), Expect = 3.9 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +2 Query: 56 LKMSYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCG 175 +K+S+ R P+I S V T TTPE+LR++ E G Sbjct: 1522 MKLSF-RTGPQIGRTKSGFVATYTSGTTPEELRKISENAG 1560 >SB_47196| Best HMM Match : Extensin_2 (HMM E-Value=0.02) Length = 376 Score = 27.9 bits (59), Expect = 3.9 Identities = 22/64 (34%), Positives = 28/64 (43%), Gaps = 2/64 (3%) Frame = +2 Query: 95 GMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPR-DRYTRESRGFAFVRFFELVTLKK 271 G LK+ LT TP D+ R G+ D IPR R + RG + +KK Sbjct: 155 GRRQLKISLLTEPDTPVDIARARSPRGQEQDPKIPRGQRQNQTPRGQRQSKIPSQRHIKK 214 Query: 272 -PWT 280 PWT Sbjct: 215 LPWT 218 >SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 593 Score = 27.9 bits (59), Expect = 3.9 Identities = 13/50 (26%), Positives = 23/50 (46%) Frame = +2 Query: 98 MVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 M + V ++ + E +R F G + I + D + +GFAFV + Sbjct: 101 MCRVYVGSINFELREEHIRTAFHPFGPINKIDLSWDPLNMKHKGFAFVEY 150 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 27.5 bits (58), Expect = 5.2 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 Query: 259 DAEEALDTMDGRMLDGRELRVQMA 330 + E+A+D DG+ LDGR ++V A Sbjct: 149 EMEKAIDEFDGQDLDGRPMKVNEA 172 >SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) Length = 929 Score = 27.1 bits (57), Expect = 6.9 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = +2 Query: 68 YGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEV 181 YG PP R + S+ V+NL+ RT+ +DL+ F + G+V Sbjct: 790 YG-PPVRTN--YSVIVENLSSRTSWQDLKDYFRKYGKV 824 >SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) Length = 672 Score = 27.1 bits (57), Expect = 6.9 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +2 Query: 119 NLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 +L T E L R F + I RD+ + +S+G+ FV F Sbjct: 223 DLGSEVTDESLTRAFAKYTSFLKAKIVRDKKSNKSKGYGFVSF 265 >SB_56972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 868 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -2 Query: 310 PCRPTFVRPSCPGLLQRHELEKPHEGESSTFP 215 PCRP RP ++ + PH S+ P Sbjct: 407 PCRPQPTRPQIESTRPQYVMSTPHSDNSNLLP 438 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 259 DAEEALDTMDGRMLDGRELRVQMA 330 + E+A+D DG+ DGR ++V A Sbjct: 57 EMEKAIDEFDGQDFDGRPMKVNQA 80 >SB_19823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 26.6 bits (56), Expect = 9.1 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Frame = -2 Query: 337 HIAP-SERE-VPCRPTFVRPS--CPGLLQRHELEKPHEGESSTFPCVPIS 200 H+ P +E + VPC P S CP + + + P E + PC P++ Sbjct: 555 HVPPVTEHDSVPCPPVTEHDSVPCPPVTEHSSVPCPPVTEHDSVPCPPVT 604 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 26.6 bits (56), Expect = 9.1 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 256 RDAEEALDTMDGRMLDGRELRVQ 324 RDAE+A+ DG DG +RV+ Sbjct: 311 RDAEDAVKGRDGHEFDGYRIRVE 333 >SB_8753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 26.6 bits (56), Expect = 9.1 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = +2 Query: 44 ISILLKMSYGRPPPRIDGMVSLKVDNLTY---RTTPEDLRRVFERCGEVGD 187 + +L ++ PPP S D LTY RT+P ++ + E GEVGD Sbjct: 4 VKLLEEVPVHLPPPVFRDPQSSIQDKLTYPTSRTSPFEVCCIDEDGGEVGD 54 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,340,044 Number of Sequences: 59808 Number of extensions: 238072 Number of successful extensions: 835 Number of sequences better than 10.0: 50 Number of HSP's better than 10.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 832 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 859323430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -