BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0320 (440 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U23484-3|AAK68298.1| 126|Caenorhabditis elegans Sr protein (spl... 95 2e-20 U23484-2|AAC46767.1| 196|Caenorhabditis elegans Sr protein (spl... 95 2e-20 Z81108-1|CAB03236.1| 83|Caenorhabditis elegans Hypothetical pr... 46 1e-05 Z35601-1|CAA84667.2| 320|Caenorhabditis elegans Hypothetical pr... 45 2e-05 AB036738-1|BAB13470.1| 320|Caenorhabditis elegans neural RNA-bi... 45 2e-05 Z81108-4|CAB03237.1| 85|Caenorhabditis elegans Hypothetical pr... 45 3e-05 AF038623-4|AAO91699.1| 177|Caenorhabditis elegans Hypothetical ... 44 7e-05 D10877-1|BAA01645.1| 346|Caenorhabditis elegans hnRNP like prot... 43 9e-05 AF038613-6|ABB51186.1| 347|Caenorhabditis elegans Human hnrnp a... 43 9e-05 AF038613-5|AAB92051.1| 346|Caenorhabditis elegans Human hnrnp a... 43 9e-05 Z81037-3|CAB02750.1| 205|Caenorhabditis elegans Hypothetical pr... 43 1e-04 U23484-11|AAC46764.2| 191|Caenorhabditis elegans Hypothetical p... 43 1e-04 Z81106-3|CAB03222.1| 84|Caenorhabditis elegans Hypothetical pr... 42 2e-04 U23484-10|AAC46772.1| 197|Caenorhabditis elegans Hypothetical p... 41 3e-04 Z92826-4|CAB07322.1| 309|Caenorhabditis elegans Hypothetical pr... 40 0.001 Z83127-4|CAB05631.1| 872|Caenorhabditis elegans Hypothetical pr... 40 0.001 AF098501-6|AAL38960.1| 315|Caenorhabditis elegans Hypothetical ... 40 0.001 AF098501-5|AAM69104.1| 335|Caenorhabditis elegans Hypothetical ... 40 0.001 AF098501-4|AAL38959.1| 336|Caenorhabditis elegans Hypothetical ... 40 0.001 Z50044-2|CAA90354.1| 256|Caenorhabditis elegans Hypothetical pr... 39 0.002 AF047662-1|AAC04442.1| 248|Caenorhabditis elegans Suppressor pr... 38 0.004 AC084197-11|AAM44397.1| 305|Caenorhabditis elegans Homologous t... 38 0.004 AC084197-10|AAY43984.1| 308|Caenorhabditis elegans Homologous t... 38 0.004 Z78419-2|CAB01702.1| 154|Caenorhabditis elegans Hypothetical pr... 37 0.007 Z97628-2|CAB10726.2| 427|Caenorhabditis elegans Hypothetical pr... 36 0.010 Z81080-5|CAB03088.2| 427|Caenorhabditis elegans Hypothetical pr... 36 0.010 Z81080-2|CAD56584.1| 358|Caenorhabditis elegans Hypothetical pr... 36 0.010 AF038613-8|AAL02515.2| 309|Caenorhabditis elegans Human hnrnp a... 36 0.010 AF038613-7|ABB51185.1| 308|Caenorhabditis elegans Human hnrnp a... 36 0.010 U41531-7|AAA83161.2| 415|Caenorhabditis elegans Feminizing gene... 36 0.013 U23450-2|AAK31468.1| 302|Caenorhabditis elegans Hypothetical pr... 36 0.013 U14946-1|AAA67723.1| 415|Caenorhabditis elegans ribonucleoprote... 36 0.013 U80455-1|AAB37881.1| 584|Caenorhabditis elegans Elav-type rna b... 35 0.023 U53931-1|AAA98566.1| 584|Caenorhabditis elegans elav-type ribon... 35 0.023 EF523770-1|ABS18836.1| 513|Caenorhabditis elegans ELAV-type RNA... 35 0.023 EF523769-1|ABS18835.1| 327|Caenorhabditis elegans ELAV-type RNA... 35 0.023 EF523768-1|ABS18834.1| 378|Caenorhabditis elegans ELAV-type RNA... 35 0.023 EF523767-1|ABS18833.1| 193|Caenorhabditis elegans ELAV-type RNA... 35 0.023 EF523766-1|ABS18832.1| 584|Caenorhabditis elegans ELAV-type RNA... 35 0.023 AF040642-5|AAN73870.2| 138|Caenorhabditis elegans Hypothetical ... 35 0.030 Z81473-3|CAB03896.4| 514|Caenorhabditis elegans Hypothetical pr... 34 0.040 AY342388-1|AAQ19851.1| 514|Caenorhabditis elegans putative RNA-... 34 0.040 Z36752-6|CAA85327.1| 456|Caenorhabditis elegans Hypothetical pr... 34 0.053 Z78536-3|CAB01717.2| 360|Caenorhabditis elegans Hypothetical pr... 33 0.070 U28944-7|AAN63457.1| 295|Caenorhabditis elegans Hypothetical pr... 33 0.070 U28944-6|AAN63456.1| 305|Caenorhabditis elegans Hypothetical pr... 33 0.070 U28944-5|AAK68191.1| 408|Caenorhabditis elegans Hypothetical pr... 33 0.070 U28944-4|AAK68192.1| 376|Caenorhabditis elegans Hypothetical pr... 33 0.070 AC024826-10|AAM97977.1| 435|Caenorhabditis elegans Hypothetical... 33 0.070 AC024826-8|AAF60795.2| 580|Caenorhabditis elegans Hypothetical ... 33 0.070 Z36238-3|CAA85276.1| 404|Caenorhabditis elegans Hypothetical pr... 33 0.12 DQ485531-1|ABF22491.1| 404|Caenorhabditis elegans RNA-binding p... 33 0.12 Z68297-5|CAC70081.1| 394|Caenorhabditis elegans Hypothetical pr... 32 0.21 U21320-5|AAA62536.2| 332|Caenorhabditis elegans Rnp (rrm rna bi... 31 0.37 Z46676-8|CAB60993.2| 388|Caenorhabditis elegans Hypothetical pr... 30 0.86 U24189-3|AAC47514.1| 398|Caenorhabditis elegans RRM-type RNA bi... 30 0.86 AL137227-1|CAB70238.2| 611|Caenorhabditis elegans Hypothetical ... 30 0.86 AL117204-22|CAB55151.1| 331|Caenorhabditis elegans Hypothetical... 29 1.1 AL132904-14|CAC35847.2| 258|Caenorhabditis elegans Hypothetical... 29 1.5 AF242767-1|AAG36874.1| 258|Caenorhabditis elegans SF2 protein. 29 1.5 U23172-15|AAN63408.1| 374|Caenorhabditis elegans Hypothetical p... 29 2.0 U23172-12|ABH03526.1| 562|Caenorhabditis elegans Hypothetical p... 29 2.0 AC024791-23|AAM81102.1| 346|Caenorhabditis elegans Rnp (rrm rna... 28 2.6 AC024791-22|AAF60676.1| 339|Caenorhabditis elegans Rnp (rrm rna... 28 2.6 AC024791-21|AAF60666.1| 749|Caenorhabditis elegans Rnp (rrm rna... 28 2.6 Z50110-2|CAA90446.1| 566|Caenorhabditis elegans Hypothetical pr... 28 3.5 Z50110-1|CAA90444.1| 692|Caenorhabditis elegans Hypothetical pr... 28 3.5 AF148954-1|AAD37411.1| 4280|Caenorhabditis elegans myotactin for... 27 4.6 AF148953-1|AAD37410.1| 4450|Caenorhabditis elegans myotactin for... 27 4.6 AF040648-5|AAK21413.1| 4450|Caenorhabditis elegans Lethal protei... 27 4.6 AF040648-4|AAK21414.2| 4280|Caenorhabditis elegans Lethal protei... 27 4.6 U28738-11|AAK68399.3| 166|Caenorhabditis elegans Sr protein (sp... 27 6.0 U28738-10|AAK72066.3| 208|Caenorhabditis elegans Sr protein (sp... 27 6.0 U28738-9|AAA68314.3| 208|Caenorhabditis elegans Sr protein (spl... 27 6.0 >U23484-3|AAK68298.1| 126|Caenorhabditis elegans Sr protein (splicing factor) protein4, isoform b protein. Length = 126 Score = 95.5 bits (227), Expect = 2e-20 Identities = 38/60 (63%), Positives = 52/60 (86%) Frame = +2 Query: 74 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 R P I+G+ SLK+DNL+Y+TTP DLRR FER G++GD++IPRD+Y+R+S+GF FVRF+E Sbjct: 10 RAAPDINGLTSLKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSKGFGFVRFYE 69 Score = 40.7 bits (91), Expect = 5e-04 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = +1 Query: 247 FRARDAEEALDTMDGRMLDGRELRVQMA 330 + RDAE ALD DG+++DGRELRV +A Sbjct: 68 YERRDAEHALDRTDGKLVDGRELRVTLA 95 >U23484-2|AAC46767.1| 196|Caenorhabditis elegans Sr protein (splicing factor) protein4, isoform a protein. Length = 196 Score = 95.5 bits (227), Expect = 2e-20 Identities = 38/60 (63%), Positives = 52/60 (86%) Frame = +2 Query: 74 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 R P I+G+ SLK+DNL+Y+TTP DLRR FER G++GD++IPRD+Y+R+S+GF FVRF+E Sbjct: 10 RAAPDINGLTSLKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSKGFGFVRFYE 69 Score = 40.7 bits (91), Expect = 5e-04 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = +1 Query: 247 FRARDAEEALDTMDGRMLDGRELRVQMA 330 + RDAE ALD DG+++DGRELRV +A Sbjct: 68 YERRDAEHALDRTDGKLVDGRELRVTLA 95 >Z81108-1|CAB03236.1| 83|Caenorhabditis elegans Hypothetical protein R09B3.2 protein. Length = 83 Score = 46.0 bits (104), Expect = 1e-05 Identities = 21/55 (38%), Positives = 32/55 (58%) Frame = +2 Query: 89 IDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 + G+ S+ V N ++TT E+L F G++ ++ I DR T RGFAF+ F E Sbjct: 1 MSGIFSVYVGNAPFQTTEEELGNFFSSIGQINNVRIVCDRETGRPRGFAFIEFAE 55 >Z35601-1|CAA84667.2| 320|Caenorhabditis elegans Hypothetical protein R10E9.1 protein. Length = 320 Score = 45.2 bits (102), Expect = 2e-05 Identities = 20/53 (37%), Positives = 33/53 (62%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVTLKK 271 + L+++TT E+LR F R GEV + + RD T+ +RGF F+ F + ++ K Sbjct: 49 IGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDK 101 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/45 (37%), Positives = 27/45 (60%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 + L+ +T ED+++ FE G+V D + D+ T+ RGF FV F Sbjct: 138 IGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTF 182 >AB036738-1|BAB13470.1| 320|Caenorhabditis elegans neural RNA-binding protein MSI-1 protein. Length = 320 Score = 45.2 bits (102), Expect = 2e-05 Identities = 20/53 (37%), Positives = 33/53 (62%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVTLKK 271 + L+++TT E+LR F R GEV + + RD T+ +RGF F+ F + ++ K Sbjct: 49 IGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDK 101 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/45 (37%), Positives = 27/45 (60%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 + L+ +T ED+++ FE G+V D + D+ T+ RGF FV F Sbjct: 138 IGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTF 182 >Z81108-4|CAB03237.1| 85|Caenorhabditis elegans Hypothetical protein R09B3.3 protein. Length = 85 Score = 44.8 bits (101), Expect = 3e-05 Identities = 22/50 (44%), Positives = 29/50 (58%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 S+ V N ++TT +DL F + G V ++ I DR T RGFAFV F E Sbjct: 5 SVYVGNAPFQTTEDDLGNYFSQAGNVSNVRIVCDRETGRPRGFAFVEFTE 54 >AF038623-4|AAO91699.1| 177|Caenorhabditis elegans Hypothetical protein T08B6.5 protein. Length = 177 Score = 43.6 bits (98), Expect = 7e-05 Identities = 18/55 (32%), Positives = 35/55 (63%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVTLK 268 S+ V N+ +++T ++ F CG+V + IP+D++T + FAFV F +L +++ Sbjct: 47 SVYVGNVDWKSTVSEIEEHFAVCGKVARVTIPKDKFTGYQKNFAFVEFQKLESVQ 101 >D10877-1|BAA01645.1| 346|Caenorhabditis elegans hnRNP like protein protein. Length = 346 Score = 43.2 bits (97), Expect = 9e-05 Identities = 20/45 (44%), Positives = 27/45 (60%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V LT TT + +R + + GE+ DI + RD T+ SRGF FV F Sbjct: 27 VGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTF 71 >AF038613-6|ABB51186.1| 347|Caenorhabditis elegans Human hnrnp a1 homolog protein1, isoform d protein. Length = 347 Score = 43.2 bits (97), Expect = 9e-05 Identities = 20/45 (44%), Positives = 27/45 (60%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V LT TT + +R + + GE+ DI + RD T+ SRGF FV F Sbjct: 27 VGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTF 71 >AF038613-5|AAB92051.1| 346|Caenorhabditis elegans Human hnrnp a1 homolog protein1, isoform a protein. Length = 346 Score = 43.2 bits (97), Expect = 9e-05 Identities = 20/45 (44%), Positives = 27/45 (60%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V LT TT + +R + + GE+ DI + RD T+ SRGF FV F Sbjct: 27 VGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTF 71 >Z81037-3|CAB02750.1| 205|Caenorhabditis elegans Hypothetical protein C17E4.5 protein. Length = 205 Score = 42.7 bits (96), Expect = 1e-04 Identities = 19/50 (38%), Positives = 29/50 (58%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 S+ V N+ Y T E++ + F CG V + I DR++ +GFA+V F E Sbjct: 79 SVYVGNVDYGATAEEIEQHFHGCGSVSRVTIQCDRFSGHPKGFAYVEFTE 128 >U23484-11|AAC46764.2| 191|Caenorhabditis elegans Hypothetical protein EEED8.4 protein. Length = 191 Score = 42.7 bits (96), Expect = 1e-04 Identities = 14/48 (29%), Positives = 32/48 (66%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 S+ + N+ + +T E++ F+ CG++ IP+D++T++ + FA++ F Sbjct: 56 SVFIGNVDFNSTIEEIEEHFKGCGQIVKTTIPKDKFTKKQKNFAYIEF 103 >Z81106-3|CAB03222.1| 84|Caenorhabditis elegans Hypothetical protein R06C1.4 protein. Length = 84 Score = 41.9 bits (94), Expect = 2e-04 Identities = 21/50 (42%), Positives = 28/50 (56%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 S+ V N+ Y+ T E++ F G V ++ I DR T RGFAFV F E Sbjct: 7 SVYVGNVPYQGTEEEIGNYFAAVGHVNNVRIVYDRETGRPRGFAFVEFSE 56 >U23484-10|AAC46772.1| 197|Caenorhabditis elegans Hypothetical protein EEED8.12 protein. Length = 197 Score = 41.1 bits (92), Expect = 3e-04 Identities = 14/48 (29%), Positives = 31/48 (64%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 S+ + N+ + +T E++ F+ CG + IP+D++T++ + FA++ F Sbjct: 62 SVFIGNVDFNSTIEEVEEHFKGCGHIVRTTIPKDKFTKKQKNFAYIEF 109 >Z92826-4|CAB07322.1| 309|Caenorhabditis elegans Hypothetical protein C18D11.4 protein. Length = 309 Score = 39.5 bits (88), Expect = 0.001 Identities = 22/51 (43%), Positives = 30/51 (58%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELV 259 L V NL+ TT +DLR VF GE+ + DR + SRGF F+ +F L+ Sbjct: 78 LGVFNLSSYTTEKDLRDVFGEFGEINKCDLVYDRPSGNSRGFGFI-YFNLI 127 >Z83127-4|CAB05631.1| 872|Caenorhabditis elegans Hypothetical protein T23F6.4 protein. Length = 872 Score = 39.5 bits (88), Expect = 0.001 Identities = 17/43 (39%), Positives = 27/43 (62%) Frame = +2 Query: 119 NLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 NL Y T +DL+ +F++ GEV ++ + D+ T +GFA V F Sbjct: 285 NLPYATKEDDLQFLFKKYGEVSEVQVVIDKKTGACKGFAIVEF 327 Score = 30.3 bits (65), Expect = 0.65 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIP-RDRYTRESRGFAFVRF 247 L V NL + + +++ +FE G V I IP + ++ RGF FV F Sbjct: 750 LLVRNLPFEASVKEVETLFETFGAVKTIRIPKKPGQKQQHRGFGFVDF 797 >AF098501-6|AAL38960.1| 315|Caenorhabditis elegans Hypothetical protein H28G03.1b protein. Length = 315 Score = 39.5 bits (88), Expect = 0.001 Identities = 20/47 (42%), Positives = 26/47 (55%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L + L++ TT E L F + G V D + RD T+ SRGF FV F Sbjct: 51 LFIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTF 97 >AF098501-5|AAM69104.1| 335|Caenorhabditis elegans Hypothetical protein H28G03.1c protein. Length = 335 Score = 39.5 bits (88), Expect = 0.001 Identities = 20/47 (42%), Positives = 26/47 (55%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L + L++ TT E L F + G V D + RD T+ SRGF FV F Sbjct: 71 LFIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTF 117 >AF098501-4|AAL38959.1| 336|Caenorhabditis elegans Hypothetical protein H28G03.1a protein. Length = 336 Score = 39.5 bits (88), Expect = 0.001 Identities = 20/47 (42%), Positives = 26/47 (55%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L + L++ TT E L F + G V D + RD T+ SRGF FV F Sbjct: 72 LFIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTF 118 >Z50044-2|CAA90354.1| 256|Caenorhabditis elegans Hypothetical protein F22B5.2 protein. Length = 256 Score = 38.7 bits (86), Expect = 0.002 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = +2 Query: 110 KVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 +V NL ++LR +F + G V I+I RD+ T +GFAFV F Sbjct: 179 RVTNLPQEMNEDELRDLFGKIGRVIRIFIARDKVTGLPKGFAFVTF 224 >AF047662-1|AAC04442.1| 248|Caenorhabditis elegans Suppressor protein 12 protein. Length = 248 Score = 37.5 bits (83), Expect = 0.004 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 V L Y T+ + L FE+ G++ + + DR T++SRG+ FV Sbjct: 39 VGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFV 81 >AC084197-11|AAM44397.1| 305|Caenorhabditis elegans Homologous to drosophila sqd (squid)protein protein 1, isoform a protein. Length = 305 Score = 37.5 bits (83), Expect = 0.004 Identities = 18/37 (48%), Positives = 24/37 (64%) Frame = +2 Query: 143 EDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 +DLR FE+ G+V DI P D+ T+ R FAF+ F E Sbjct: 124 QDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEE 160 Score = 34.7 bits (76), Expect = 0.030 Identities = 18/45 (40%), Positives = 22/45 (48%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V ++ EDL F + GEV + DR SRGFAFV F Sbjct: 33 VGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEF 77 >AC084197-10|AAY43984.1| 308|Caenorhabditis elegans Homologous to drosophila sqd (squid)protein protein 1, isoform b protein. Length = 308 Score = 37.5 bits (83), Expect = 0.004 Identities = 18/37 (48%), Positives = 24/37 (64%) Frame = +2 Query: 143 EDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 +DLR FE+ G+V DI P D+ T+ R FAF+ F E Sbjct: 124 QDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEE 160 Score = 34.7 bits (76), Expect = 0.030 Identities = 18/45 (40%), Positives = 22/45 (48%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V ++ EDL F + GEV + DR SRGFAFV F Sbjct: 33 VGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEF 77 >Z78419-2|CAB01702.1| 154|Caenorhabditis elegans Hypothetical protein F26A3.2 protein. Length = 154 Score = 36.7 bits (81), Expect = 0.007 Identities = 16/49 (32%), Positives = 28/49 (57%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFF 250 +L V NL+Y T + + +F R G+V + + DR+ + GF FV ++ Sbjct: 38 TLYVGNLSYYTKEDQVYELFGRAGDVRRVIMGLDRFKKTPCGFCFVEYY 86 >Z97628-2|CAB10726.2| 427|Caenorhabditis elegans Hypothetical protein F39H2.2a protein. Length = 427 Score = 36.3 bits (80), Expect = 0.010 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +2 Query: 134 TTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 TT EDL +F R G++ + I RDR + +S +AF+ F Sbjct: 252 TTDEDLEIIFSRFGKINNCEIVRDRRSGDSLQYAFIEF 289 >Z81080-5|CAB03088.2| 427|Caenorhabditis elegans Hypothetical protein F39H2.2a protein. Length = 427 Score = 36.3 bits (80), Expect = 0.010 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +2 Query: 134 TTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 TT EDL +F R G++ + I RDR + +S +AF+ F Sbjct: 252 TTDEDLEIIFSRFGKINNCEIVRDRRSGDSLQYAFIEF 289 >Z81080-2|CAD56584.1| 358|Caenorhabditis elegans Hypothetical protein F39H2.2b protein. Length = 358 Score = 36.3 bits (80), Expect = 0.010 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +2 Query: 134 TTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 TT EDL +F R G++ + I RDR + +S +AF+ F Sbjct: 183 TTDEDLEIIFSRFGKINNCEIVRDRRSGDSLQYAFIEF 220 >AF038613-8|AAL02515.2| 309|Caenorhabditis elegans Human hnrnp a1 homolog protein1, isoform b protein. Length = 309 Score = 36.3 bits (80), Expect = 0.010 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +2 Query: 149 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 +R + + GE+ DI + RD T+ SRGF FV F Sbjct: 1 MREFYSQFGEITDIIVMRDPTTKRSRGFGFVTF 33 >AF038613-7|ABB51185.1| 308|Caenorhabditis elegans Human hnrnp a1 homolog protein1, isoform c protein. Length = 308 Score = 36.3 bits (80), Expect = 0.010 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +2 Query: 149 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 +R + + GE+ DI + RD T+ SRGF FV F Sbjct: 1 MREFYSQFGEITDIIVMRDPTTKRSRGFGFVTF 33 >U41531-7|AAA83161.2| 415|Caenorhabditis elegans Feminizing gene on x protein 1 protein. Length = 415 Score = 35.9 bits (79), Expect = 0.013 Identities = 20/50 (40%), Positives = 28/50 (56%) Frame = +2 Query: 92 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 DG L V N+ +R DL+ +FE+ G V D+ I + R S+GF FV Sbjct: 150 DGPKRLHVSNIPFRFRDPDLKTMFEKFGVVSDVEIIFNE--RGSKGFGFV 197 Score = 27.1 bits (57), Expect = 6.0 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 250 RARDAEEALDTMDGRMLDGRELRVQMA 330 R +DAE A + G M++GR++ V A Sbjct: 201 RPQDAERARQELHGSMIEGRKIEVNCA 227 >U23450-2|AAK31468.1| 302|Caenorhabditis elegans Hypothetical protein C30B5.4 protein. Length = 302 Score = 35.9 bits (79), Expect = 0.013 Identities = 17/43 (39%), Positives = 28/43 (65%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 + L+Y + D+ VF + GEV +I + RD+ T +S+GFAF+ Sbjct: 42 IGGLSYALSEGDVIAVFSQYGEVMNINLIRDKDTGKSKGFAFL 84 >U14946-1|AAA67723.1| 415|Caenorhabditis elegans ribonucleoprotein protein. Length = 415 Score = 35.9 bits (79), Expect = 0.013 Identities = 20/50 (40%), Positives = 28/50 (56%) Frame = +2 Query: 92 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 DG L V N+ +R DL+ +FE+ G V D+ I + R S+GF FV Sbjct: 150 DGPKRLHVSNIPFRFRDPDLKTMFEKFGVVSDVEIIFNE--RGSKGFGFV 197 Score = 27.1 bits (57), Expect = 6.0 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 250 RARDAEEALDTMDGRMLDGRELRVQMA 330 R +DAE A + G M++GR++ V A Sbjct: 201 RPQDAERARQELHGSMIEGRKIEVNCA 227 >U80455-1|AAB37881.1| 584|Caenorhabditis elegans Elav-type rna binding protein familyprotein 1, isoform a protein. Length = 584 Score = 35.1 bits (77), Expect = 0.023 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = +2 Query: 101 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFF 250 + + V + + D RR+FE+ G V I RD+ T+ S+G FV F+ Sbjct: 55 IKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFY 104 >U53931-1|AAA98566.1| 584|Caenorhabditis elegans elav-type ribonucleoprotein protein. Length = 584 Score = 35.1 bits (77), Expect = 0.023 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = +2 Query: 101 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFF 250 + + V + + D RR+FE+ G V I RD+ T+ S+G FV F+ Sbjct: 55 IKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFY 104 >EF523770-1|ABS18836.1| 513|Caenorhabditis elegans ELAV-type RNA binding protein variantE protein. Length = 513 Score = 35.1 bits (77), Expect = 0.023 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = +2 Query: 101 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFF 250 + + V + + D RR+FE+ G V I RD+ T+ S+G FV F+ Sbjct: 55 IKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFY 104 >EF523769-1|ABS18835.1| 327|Caenorhabditis elegans ELAV-type RNA binding protein variantD protein. Length = 327 Score = 35.1 bits (77), Expect = 0.023 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = +2 Query: 101 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFF 250 + + V + + D RR+FE+ G V I RD+ T+ S+G FV F+ Sbjct: 55 IKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFY 104 >EF523768-1|ABS18834.1| 378|Caenorhabditis elegans ELAV-type RNA binding protein variantC protein. Length = 378 Score = 35.1 bits (77), Expect = 0.023 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = +2 Query: 101 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFF 250 + + V + + D RR+FE+ G V I RD+ T+ S+G FV F+ Sbjct: 55 IKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFY 104 >EF523767-1|ABS18833.1| 193|Caenorhabditis elegans ELAV-type RNA binding protein variantB protein. Length = 193 Score = 35.1 bits (77), Expect = 0.023 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = +2 Query: 101 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFF 250 + + V + + D RR+FE+ G V I RD+ T+ S+G FV F+ Sbjct: 55 IKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFY 104 >EF523766-1|ABS18832.1| 584|Caenorhabditis elegans ELAV-type RNA binding protein variantA protein. Length = 584 Score = 35.1 bits (77), Expect = 0.023 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = +2 Query: 101 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFF 250 + + V + + D RR+FE+ G V I RD+ T+ S+G FV F+ Sbjct: 55 IKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFY 104 >AF040642-5|AAN73870.2| 138|Caenorhabditis elegans Hypothetical protein C50D2.5 protein. Length = 138 Score = 34.7 bits (76), Expect = 0.030 Identities = 20/63 (31%), Positives = 35/63 (55%) Frame = +2 Query: 80 PPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELV 259 PP ++ ++ +K NL Y+ T E++ +F + G V I + T E+RG AFV + ++ Sbjct: 14 PPEVNRILYIK--NLPYKITTEEMYEIFGKFGAVRQIRVGN---TAETRGTAFVVYEDIF 68 Query: 260 TLK 268 K Sbjct: 69 DAK 71 >Z81473-3|CAB03896.4| 514|Caenorhabditis elegans Hypothetical protein C17D12.2 protein. Length = 514 Score = 34.3 bits (75), Expect = 0.040 Identities = 16/56 (28%), Positives = 30/56 (53%) Frame = +2 Query: 80 PPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 P + + L V + +DLR +FE+ G++ + I +D+YT +G AF+ + Sbjct: 22 PVKDPDAIKLFVGQIPRNLEEKDLRHLFEQFGKIYEFTILKDKYTGMHKGCAFLTY 77 >AY342388-1|AAQ19851.1| 514|Caenorhabditis elegans putative RNA-binding protein protein. Length = 514 Score = 34.3 bits (75), Expect = 0.040 Identities = 16/56 (28%), Positives = 30/56 (53%) Frame = +2 Query: 80 PPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 P + + L V + +DLR +FE+ G++ + I +D+YT +G AF+ + Sbjct: 22 PVKDPDAIKLFVGQIPRNLEEKDLRHLFEQFGKIYEFTILKDKYTGMHKGCAFLTY 77 >Z36752-6|CAA85327.1| 456|Caenorhabditis elegans Hypothetical protein F35H8.5 protein. Length = 456 Score = 33.9 bits (74), Expect = 0.053 Identities = 15/52 (28%), Positives = 28/52 (53%) Frame = +2 Query: 92 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 + +L ++ L T E++R +F GE+ + RD+ T +S G+ FV + Sbjct: 39 ESKTNLIINYLPQGMTQEEVRSLFTSIGEIESCKLVRDKVTGQSLGYGFVNY 90 Score = 32.7 bits (71), Expect = 0.12 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +2 Query: 56 LKMSYGRPP-PRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 232 +K+SY RP +I G +L V + T +L +F G++ I D T S+G Sbjct: 113 IKVSYARPSNDQIKGS-NLYVSGIPKSMTLHELESIFRPFGQIITSRILSDNVTGLSKGV 171 Query: 233 AFVRF 247 FVRF Sbjct: 172 GFVRF 176 >Z78536-3|CAB01717.2| 360|Caenorhabditis elegans Hypothetical protein C07A4.1 protein. Length = 360 Score = 33.5 bits (73), Expect = 0.070 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V +L+ + E L+ F + GEV + + RD T++S+G+ FV F Sbjct: 139 VGDLSKDVSNELLKSTFTKFGEVSEAKVIRDVQTQKSKGYGFVSF 183 >U28944-7|AAN63457.1| 295|Caenorhabditis elegans Hypothetical protein C18A3.5f protein. Length = 295 Score = 33.5 bits (73), Expect = 0.070 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V +L+ + LR F+ G+V D + RD T +S+G+ FV + Sbjct: 26 VGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSY 70 >U28944-6|AAN63456.1| 305|Caenorhabditis elegans Hypothetical protein C18A3.5e protein. Length = 305 Score = 33.5 bits (73), Expect = 0.070 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V +L+ + LR F+ G+V D + RD T +S+G+ FV + Sbjct: 36 VGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSY 80 >U28944-5|AAK68191.1| 408|Caenorhabditis elegans Hypothetical protein C18A3.5a protein. Length = 408 Score = 33.5 bits (73), Expect = 0.070 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V +L+ + LR F+ G+V D + RD T +S+G+ FV + Sbjct: 139 VGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSY 183 >U28944-4|AAK68192.1| 376|Caenorhabditis elegans Hypothetical protein C18A3.5b protein. Length = 376 Score = 33.5 bits (73), Expect = 0.070 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V +L+ + LR F+ G+V D + RD T +S+G+ FV + Sbjct: 107 VGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSY 151 >AC024826-10|AAM97977.1| 435|Caenorhabditis elegans Hypothetical protein Y55F3AM.3c protein. Length = 435 Score = 33.5 bits (73), Expect = 0.070 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 +L + + T P DL F G V D+ I D T S+G +V F++ Sbjct: 26 TLLIMQIARDTRPRDLEEFFSAVGAVRDVRIITDSRTGRSKGICYVEFWD 75 >AC024826-8|AAF60795.2| 580|Caenorhabditis elegans Hypothetical protein Y55F3AM.3a protein. Length = 580 Score = 33.5 bits (73), Expect = 0.070 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 +L + + T P DL F G V D+ I D T S+G +V F++ Sbjct: 171 TLLIMQIARDTRPRDLEEFFSAVGAVRDVRIITDSRTGRSKGICYVEFWD 220 >Z36238-3|CAA85276.1| 404|Caenorhabditis elegans Hypothetical protein R74.5a protein. Length = 404 Score = 32.7 bits (71), Expect = 0.12 Identities = 19/50 (38%), Positives = 27/50 (54%) Frame = +2 Query: 92 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 DG L V N+ ++ DL +FE+ G V D+ I + R S+GF FV Sbjct: 97 DGPRRLHVSNIPFKYREPDLTAMFEKVGPVVDVEIIFNE--RGSKGFGFV 144 >DQ485531-1|ABF22491.1| 404|Caenorhabditis elegans RNA-binding protein ASD-1 protein. Length = 404 Score = 32.7 bits (71), Expect = 0.12 Identities = 19/50 (38%), Positives = 27/50 (54%) Frame = +2 Query: 92 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 DG L V N+ ++ DL +FE+ G V D+ I + R S+GF FV Sbjct: 97 DGPRRLHVSNIPFKYREPDLTAMFEKVGPVVDVEIIFNE--RGSKGFGFV 144 >Z68297-5|CAC70081.1| 394|Caenorhabditis elegans Hypothetical protein F11A10.7 protein. Length = 394 Score = 31.9 bits (69), Expect = 0.21 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +2 Query: 101 VSLKVDNLTYRTTPEDLRRVFE-RCGEVGDIYIPRDRYTRESRGFAFVRF 247 +++ V NL + T + L F + G V + I RD+ T + +GFAFV F Sbjct: 246 MAIFVGNLPFEITEDALITFFSAQIGPVEAVRIVRDKDTGKGKGFAFVNF 295 >U21320-5|AAA62536.2| 332|Caenorhabditis elegans Rnp (rrm rna binding domain) containingprotein 7 protein. Length = 332 Score = 31.1 bits (67), Expect = 0.37 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 +L V + Y T+ LRR FE G++ + + D + RG+AF+ + Sbjct: 105 TLFVGRINYETSESKLRREFEAYGKIKKLTMVHDE-AGKPRGYAFIEY 151 >Z46676-8|CAB60993.2| 388|Caenorhabditis elegans Hypothetical protein C08B11.5 protein. Length = 388 Score = 29.9 bits (64), Expect = 0.86 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 ++ V L + + L + + G V + +P+DR T +GF FV F Sbjct: 14 TIYVGGLDEKVSESILWELMVQAGPVVSVNMPKDRVTANHQGFGFVEF 61 >U24189-3|AAC47514.1| 398|Caenorhabditis elegans RRM-type RNA binding protein protein. Length = 398 Score = 29.9 bits (64), Expect = 0.86 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 ++ V L + + L + + G V + +P+DR T +GF FV F Sbjct: 24 TIYVGGLDEKVSESILWELMVQAGPVVSVNMPKDRVTANHQGFGFVEF 71 >AL137227-1|CAB70238.2| 611|Caenorhabditis elegans Hypothetical protein F58D5.1 protein. Length = 611 Score = 29.9 bits (64), Expect = 0.86 Identities = 18/68 (26%), Positives = 34/68 (50%), Gaps = 8/68 (11%) Frame = +2 Query: 68 YGRPPPRIDGMVS--------LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRES 223 +G PPP +G + + V ++ + L +FE+ G++ D+ + D + S Sbjct: 181 FGGPPPDWEGPATGPAGQGHEIYVGHIPTDVFEDTLVPLFEKSGKIWDLRLMMDPMSGAS 240 Query: 224 RGFAFVRF 247 RG+AFV + Sbjct: 241 RGYAFVTY 248 >AL117204-22|CAB55151.1| 331|Caenorhabditis elegans Hypothetical protein Y116A8C.34 protein. Length = 331 Score = 29.5 bits (63), Expect = 1.1 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 +L V T T + L F G+V I IP D + + RGF FV F Sbjct: 12 TLYVGGFTEDVTEKVLMAAFIPFGDVVAISIPMDYESGKHRGFGFVEF 59 >AL132904-14|CAC35847.2| 258|Caenorhabditis elegans Hypothetical protein Y111B2A.18 protein. Length = 258 Score = 29.1 bits (62), Expect = 1.5 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 256 RDAEEALDTMDGRMLDGRELRVQ 324 RDAE+A+ DG DGR +RV+ Sbjct: 57 RDAEDAVRARDGYEFDGRRIRVE 79 >AF242767-1|AAG36874.1| 258|Caenorhabditis elegans SF2 protein. Length = 258 Score = 29.1 bits (62), Expect = 1.5 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 256 RDAEEALDTMDGRMLDGRELRVQ 324 RDAE+A+ DG DGR +RV+ Sbjct: 57 RDAEDAVRARDGYEFDGRRIRVE 79 >U23172-15|AAN63408.1| 374|Caenorhabditis elegans Hypothetical protein F25B5.7d protein. Length = 374 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = +1 Query: 262 AEEALDTMDGRMLDGRELRVQMA 330 AE A + +DGR++ GR++RV+ A Sbjct: 163 AESAKEAIDGRIIHGRQVRVRFA 185 >U23172-12|ABH03526.1| 562|Caenorhabditis elegans Hypothetical protein F25B5.7a protein. Length = 562 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = +1 Query: 262 AEEALDTMDGRMLDGRELRVQMA 330 AE A + +DGR++ GR++RV+ A Sbjct: 163 AESAKEAIDGRIIHGRQVRVRFA 185 >AC024791-23|AAM81102.1| 346|Caenorhabditis elegans Rnp (rrm rna binding domain) containingprotein 6, isoform c protein. Length = 346 Score = 28.3 bits (60), Expect = 2.6 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 146 DLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVT 262 DL+ VFE GE+ + R R RGF ++ F L + Sbjct: 222 DLKSVFEAFGEIVKCQLARAPTGRGHRGFGYLEFNNLTS 260 Score = 27.5 bits (58), Expect = 4.6 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +2 Query: 98 MVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 M + V ++++ + LRR F+ G + I + D T + FAFV + Sbjct: 101 MSRIYVGSISFEIREDMLRRAFDPFGPIKSINMSWDPATGHHKTFAFVEY 150 >AC024791-22|AAF60676.1| 339|Caenorhabditis elegans Rnp (rrm rna binding domain) containingprotein 6, isoform a protein. Length = 339 Score = 28.3 bits (60), Expect = 2.6 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 146 DLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVT 262 DL+ VFE GE+ + R R RGF ++ F L + Sbjct: 222 DLKSVFEAFGEIVKCQLARAPTGRGHRGFGYLEFNNLTS 260 Score = 27.5 bits (58), Expect = 4.6 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +2 Query: 98 MVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 M + V ++++ + LRR F+ G + I + D T + FAFV + Sbjct: 101 MSRIYVGSISFEIREDMLRRAFDPFGPIKSINMSWDPATGHHKTFAFVEY 150 >AC024791-21|AAF60666.1| 749|Caenorhabditis elegans Rnp (rrm rna binding domain) containingprotein 6, isoform b protein. Length = 749 Score = 28.3 bits (60), Expect = 2.6 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 146 DLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVT 262 DL+ VFE GE+ + R R RGF ++ F L + Sbjct: 222 DLKSVFEAFGEIVKCQLARAPTGRGHRGFGYLEFNNLTS 260 Score = 27.5 bits (58), Expect = 4.6 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +2 Query: 98 MVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 M + V ++++ + LRR F+ G + I + D T + FAFV + Sbjct: 101 MSRIYVGSISFEIREDMLRRAFDPFGPIKSINMSWDPATGHHKTFAFVEY 150 >Z50110-2|CAA90446.1| 566|Caenorhabditis elegans Hypothetical protein F18H3.3b protein. Length = 566 Score = 27.9 bits (59), Expect = 3.5 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +1 Query: 259 DAEEALDTMDGRMLDGRELRV 321 DAE ALDTM+ ++ GR +R+ Sbjct: 110 DAERALDTMNFEVIHGRPMRI 130 >Z50110-1|CAA90444.1| 692|Caenorhabditis elegans Hypothetical protein F18H3.3a protein. Length = 692 Score = 27.9 bits (59), Expect = 3.5 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +1 Query: 259 DAEEALDTMDGRMLDGRELRV 321 DAE ALDTM+ ++ GR +R+ Sbjct: 110 DAERALDTMNFEVIHGRPMRI 130 >AF148954-1|AAD37411.1| 4280|Caenorhabditis elegans myotactin form A protein. Length = 4280 Score = 27.5 bits (58), Expect = 4.6 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = -2 Query: 328 PSEREVPCRPTFVRPSCPGLLQRHELEKPHEGESSTFPCVPISGNVD 188 P VP + P P LQ E PH E S P P GN+D Sbjct: 2706 PFSEWVPFTTSATNPPAPSDLQE-EATFPHAIEISWLPPTPPHGNID 2751 >AF148953-1|AAD37410.1| 4450|Caenorhabditis elegans myotactin form B protein. Length = 4450 Score = 27.5 bits (58), Expect = 4.6 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = -2 Query: 328 PSEREVPCRPTFVRPSCPGLLQRHELEKPHEGESSTFPCVPISGNVD 188 P VP + P P LQ E PH E S P P GN+D Sbjct: 2706 PFSEWVPFTTSATNPPAPSDLQE-EATFPHAIEISWLPPTPPHGNID 2751 >AF040648-5|AAK21413.1| 4450|Caenorhabditis elegans Lethal protein 805, isoform b protein. Length = 4450 Score = 27.5 bits (58), Expect = 4.6 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = -2 Query: 328 PSEREVPCRPTFVRPSCPGLLQRHELEKPHEGESSTFPCVPISGNVD 188 P VP + P P LQ E PH E S P P GN+D Sbjct: 2706 PFSEWVPFTTSATNPPAPSDLQE-EATFPHAIEISWLPPTPPHGNID 2751 >AF040648-4|AAK21414.2| 4280|Caenorhabditis elegans Lethal protein 805, isoform a protein. Length = 4280 Score = 27.5 bits (58), Expect = 4.6 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = -2 Query: 328 PSEREVPCRPTFVRPSCPGLLQRHELEKPHEGESSTFPCVPISGNVD 188 P VP + P P LQ E PH E S P P GN+D Sbjct: 2706 PFSEWVPFTTSATNPPAPSDLQE-EATFPHAIEISWLPPTPPHGNID 2751 >U28738-11|AAK68399.3| 166|Caenorhabditis elegans Sr protein (splicing factor) protein5, isoform b protein. Length = 166 Score = 27.1 bits (57), Expect = 6.0 Identities = 12/28 (42%), Positives = 20/28 (71%), Gaps = 2/28 (7%) Frame = +1 Query: 253 ARDAEEALDTMDGRMLDGRELR--VQMA 330 +RDAE+A +DG+ ++G +R V+MA Sbjct: 45 SRDAEDACHDLDGKTMEGSSMRLVVEMA 72 >U28738-10|AAK72066.3| 208|Caenorhabditis elegans Sr protein (splicing factor) protein5, isoform d protein. Length = 208 Score = 27.1 bits (57), Expect = 6.0 Identities = 12/28 (42%), Positives = 20/28 (71%), Gaps = 2/28 (7%) Frame = +1 Query: 253 ARDAEEALDTMDGRMLDGRELR--VQMA 330 +RDAE+A +DG+ ++G +R V+MA Sbjct: 45 SRDAEDACHDLDGKTMEGSSMRLVVEMA 72 >U28738-9|AAA68314.3| 208|Caenorhabditis elegans Sr protein (splicing factor) protein5, isoform a protein. Length = 208 Score = 27.1 bits (57), Expect = 6.0 Identities = 12/28 (42%), Positives = 20/28 (71%), Gaps = 2/28 (7%) Frame = +1 Query: 253 ARDAEEALDTMDGRMLDGRELR--VQMA 330 +RDAE+A +DG+ ++G +R V+MA Sbjct: 45 SRDAEDACHDLDGKTMEGSSMRLVVEMA 72 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,007,334 Number of Sequences: 27780 Number of extensions: 177421 Number of successful extensions: 590 Number of sequences better than 10.0: 74 Number of HSP's better than 10.0 without gapping: 547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 590 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 756625558 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -