BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0320 (440 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 68 3e-12 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 68 3e-12 At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL3... 58 2e-09 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 58 3e-09 At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33... 58 3e-09 At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28... 53 7e-08 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 50 7e-07 At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ... 47 5e-06 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 45 2e-05 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 45 2e-05 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 44 3e-05 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 44 3e-05 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 43 8e-05 At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing ... 43 8e-05 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 43 8e-05 At5g51120.1 68418.m06339 polyadenylate-binding protein, putative... 43 1e-04 At5g65260.1 68418.m08209 polyadenylate-binding protein family pr... 42 2e-04 At5g10350.2 68418.m01201 polyadenylate-binding protein family pr... 42 2e-04 At5g10350.1 68418.m01200 polyadenylate-binding protein family pr... 42 2e-04 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 42 2e-04 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 42 2e-04 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 42 2e-04 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 42 2e-04 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 42 2e-04 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 42 2e-04 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 42 2e-04 At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 41 3e-04 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 41 4e-04 At2g47310.1 68415.m05906 flowering time control protein-related ... 41 4e-04 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 41 4e-04 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 40 6e-04 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 40 6e-04 At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing ... 40 0.001 At3g11400.1 68416.m01390 eukaryotic translation initiation facto... 40 0.001 At5g44200.1 68418.m05408 nuclear cap-binding protein, putative s... 39 0.001 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 39 0.001 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 39 0.001 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 39 0.001 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 39 0.001 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 39 0.002 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 39 0.002 At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing ... 39 0.002 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 38 0.002 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 38 0.002 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 38 0.002 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 38 0.003 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 38 0.003 At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa... 38 0.004 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 37 0.005 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 37 0.005 At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonu... 37 0.005 At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonu... 37 0.005 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 37 0.007 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 37 0.007 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 36 0.009 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 36 0.009 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 36 0.009 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 36 0.009 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 36 0.009 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 36 0.009 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 36 0.009 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 36 0.009 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 36 0.009 At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ... 36 0.009 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 36 0.012 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 36 0.012 At5g06000.1 68418.m00665 eukaryotic translation initiation facto... 36 0.016 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 36 0.016 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 36 0.016 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 36 0.016 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 36 0.016 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 36 0.016 At4g10110.1 68417.m01654 RNA recognition motif (RRM)-containing ... 35 0.021 At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 35 0.021 At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing ... 35 0.021 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 35 0.021 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 35 0.021 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 35 0.021 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 35 0.021 At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing ... 35 0.028 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 35 0.028 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 35 0.028 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 35 0.028 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 35 0.028 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 34 0.037 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 34 0.049 At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ... 34 0.049 At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ... 34 0.049 At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ... 34 0.049 At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing ... 33 0.065 At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing ... 33 0.065 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 33 0.085 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 33 0.11 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 32 0.20 At2g37510.1 68415.m04600 RNA-binding protein, putative similar t... 32 0.20 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 32 0.20 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 32 0.20 At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative stro... 31 0.26 At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing ... 31 0.26 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 31 0.26 At1g51510.1 68414.m05797 RNA-binding protein, putative similar t... 31 0.26 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 31 0.26 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 31 0.26 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 31 0.26 At4g28490.1 68417.m04076 leucine-rich repeat transmembrane prote... 31 0.34 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 31 0.34 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 31 0.34 At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing ... 31 0.46 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 31 0.46 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 30 0.60 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 30 0.60 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 30 0.60 At5g03580.1 68418.m00316 polyadenylate-binding protein, putative... 30 0.80 At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit... 30 0.80 At1g47620.1 68414.m05289 cytochrome P450, putative similar to cy... 30 0.80 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 29 1.1 At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR... 29 1.1 At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing ... 29 1.1 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 29 1.1 At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, pu... 29 1.1 At5g59950.3 68418.m07518 RNA and export factor-binding protein, ... 29 1.4 At5g59950.2 68418.m07519 RNA and export factor-binding protein, ... 29 1.4 At5g59950.1 68418.m07517 RNA and export factor-binding protein, ... 29 1.4 At3g09160.1 68416.m01082 RNA recognition motif (RRM)-containing ... 29 1.4 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 29 1.4 At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing ... 29 1.8 At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ... 29 1.8 At5g03480.1 68418.m00304 expressed protein ; expression support... 29 1.8 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 29 1.8 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 29 1.8 At3g46020.1 68416.m04979 RNA-binding protein, putative similar t... 29 1.8 At5g51300.2 68418.m06360 splicing factor-related contains simila... 28 2.4 At5g51300.1 68418.m06359 splicing factor-related contains simila... 28 2.4 At4g08750.1 68417.m01443 RNA recognition motif (RRM)-containing ... 28 2.4 At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) ide... 28 2.4 At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) ide... 28 2.4 At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) ide... 28 2.4 At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing ... 28 2.4 At2g37150.2 68415.m04558 zinc finger (C3HC4-type RING finger) fa... 28 2.4 At2g37150.1 68415.m04557 zinc finger (C3HC4-type RING finger) fa... 28 2.4 At5g37720.1 68418.m04541 RNA and export factor-binding protein, ... 28 3.2 At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RS... 27 4.2 At3g49150.1 68416.m05372 F-box family protein contains F-box dom... 27 4.2 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 27 5.6 At3g44530.1 68416.m04786 transducin family protein / WD-40 repea... 27 7.4 At1g37140.1 68414.m04640 RNA-binding protein, putative similar t... 27 7.4 At5g49290.1 68418.m06100 leucine-rich repeat family protein cont... 26 9.8 At5g47020.1 68418.m05795 glycine-rich protein strong similarity ... 26 9.8 At5g06400.1 68418.m00716 pentatricopeptide (PPR) repeat-containi... 26 9.8 At5g03500.1 68418.m00306 transcriptional co-activator-related lo... 26 9.8 At4g32720.1 68417.m04657 RNA recognition motif (RRM)-containing ... 26 9.8 At3g62210.1 68416.m06989 expressed protein contains Pfam profile... 26 9.8 At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing ... 26 9.8 At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30)... 26 9.8 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 67.7 bits (158), Expect = 3e-12 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 1/61 (1%) Frame = +2 Query: 68 YGRP-PPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVR 244 +GR PP I SL V N+T+RTT +DL +F + G+V D++IPRDR T +SRGFAFVR Sbjct: 4 FGRSGPPDISDTYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFVR 63 Query: 245 F 247 + Sbjct: 64 Y 64 Score = 32.3 bits (70), Expect = 0.15 Identities = 12/24 (50%), Positives = 20/24 (83%) Frame = +1 Query: 259 DAEEALDTMDGRMLDGRELRVQMA 330 +A +A++ +DGR++DGRE+ VQ A Sbjct: 69 EAHKAVERLDGRVVDGREITVQFA 92 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 67.7 bits (158), Expect = 3e-12 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 1/61 (1%) Frame = +2 Query: 68 YGRP-PPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVR 244 +GR PP I SL V N+T+RTT +DL +F + G+V D++IPRDR T +SRGFAFVR Sbjct: 4 FGRSGPPDISDTYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFVR 63 Query: 245 F 247 + Sbjct: 64 Y 64 Score = 32.3 bits (70), Expect = 0.15 Identities = 12/24 (50%), Positives = 20/24 (83%) Frame = +1 Query: 259 DAEEALDTMDGRMLDGRELRVQMA 330 +A +A++ +DGR++DGRE+ VQ A Sbjct: 69 EAHKAVERLDGRVVDGREITVQFA 92 >At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL30a) almost identical to SC35-like splicing factor SCL30a GI:9843661 from [Arabidopsis thaliana]; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 58.4 bits (135), Expect = 2e-09 Identities = 27/50 (54%), Positives = 34/50 (68%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 SL V NL + EDLRR FE+ G V DIY+PRD YT + RGF F++F + Sbjct: 38 SLLVRNLRHDCRQEDLRRPFEQFGPVKDIYLPRDYYTGDPRGFGFIQFMD 87 Score = 26.6 bits (56), Expect = 7.4 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +1 Query: 259 DAEEALDTMDGRMLDGRELRVQMA 330 DA EA MDG +L GREL V A Sbjct: 90 DAAEAKHQMDGYLLLGRELTVVFA 113 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 57.6 bits (133), Expect = 3e-09 Identities = 27/50 (54%), Positives = 33/50 (66%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 SL V N+ PE+LR FER G V D+YIPRD Y+ + RGFAFV F + Sbjct: 48 SLLVRNIPLDCRPEELREPFERFGPVRDVYIPRDYYSGQPRGFAFVEFVD 97 >At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33) nearly identical to SC35-like splicing factor SCL33, 33 kD [Arabidopsis thaliana] GI:9843659 Length = 220 Score = 57.6 bits (133), Expect = 3e-09 Identities = 27/50 (54%), Positives = 34/50 (68%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 SL V NL + EDLR+ FE+ G V DIY+PRD YT + RGF FV+F + Sbjct: 37 SLLVRNLRHDCRQEDLRKSFEQFGPVKDIYLPRDYYTGDPRGFGFVQFMD 86 >At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28) nearly identical to SC35-like splicing factor SCL28, 28 kD [Arabidopsis thaliana] GI:9843655; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 236 Score = 53.2 bits (122), Expect = 7e-08 Identities = 25/51 (49%), Positives = 31/51 (60%) Frame = +2 Query: 95 GMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 G L + NL P DLR FER G + DIY+PR+ YT E RGF FV++ Sbjct: 45 GPSGLLIRNLPLDARPNDLRDSFERFGPLKDIYLPRNYYTGEPRGFGFVKY 95 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 50.0 bits (114), Expect = 7e-07 Identities = 22/50 (44%), Positives = 33/50 (66%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVT 262 V NLT+RTT +DLRR FE+ G+V D + + Y S+G+ F+ F + V+ Sbjct: 16 VGNLTWRTTADDLRRYFEQFGQVVDANVVSETYPGRSKGYGFITFRDYVS 65 >At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing protein low similarity to RNA-binding protein RGP-3 [Nicotiana sylvestris] GI:1009363; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 156 Score = 47.2 bits (107), Expect = 5e-06 Identities = 24/58 (41%), Positives = 33/58 (56%) Frame = +2 Query: 83 PRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFEL 256 P+ + +L V L+ RTT E LR F + GEV D + DR + S+GF FVR+ L Sbjct: 50 PQAEPSTNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRYATL 107 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 45.2 bits (102), Expect = 2e-05 Identities = 21/46 (45%), Positives = 30/46 (65%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 SL V L++R T DL F + G+V D+++ D +TRESRGF F+ Sbjct: 46 SLYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFI 91 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 45.2 bits (102), Expect = 2e-05 Identities = 21/46 (45%), Positives = 30/46 (65%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 SL V L++R T DL F + G+V D+++ D +TRESRGF F+ Sbjct: 76 SLYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFI 121 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 44.4 bits (100), Expect = 3e-05 Identities = 25/63 (39%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = +2 Query: 68 YGRPPPRIDGMVS-LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVR 244 YGR P G+ + + V L + +DLR F R G + D YIP+D RGF FV Sbjct: 228 YGRGEPTTRGIGNKIFVGRLPQEASVDDLRDYFGRFGHIQDAYIPKDPKRSGHRGFGFVT 287 Query: 245 FFE 253 F E Sbjct: 288 FAE 290 Score = 39.9 bits (89), Expect = 7e-04 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +2 Query: 146 DLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 D R FER GE+ D+Y+P+D +++ RG F+ F Sbjct: 106 DFRSHFERYGEITDLYMPKDYNSKQHRGIGFITF 139 Score = 29.5 bits (63), Expect = 1.1 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 143 EDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 + L+ + G++ D + +DR T SRGF +V F Sbjct: 17 DGLKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTF 51 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 44.4 bits (100), Expect = 3e-05 Identities = 22/45 (48%), Positives = 26/45 (57%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V NL+ TT + LR F G V D + RDRYT SRGF FV + Sbjct: 7 VGNLSPTTTDDMLREAFSGYGNVVDAIVMRDRYTDRSRGFGFVTY 51 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 43.2 bits (97), Expect = 8e-05 Identities = 21/69 (30%), Positives = 39/69 (56%) Frame = +2 Query: 59 KMSYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAF 238 K S G P +DG + + NL + TT D+R++F C + + + +++ T E +G+A Sbjct: 248 KTSSGFAPEMVDGYNRVYIGNLAWDTTERDIRKLFSDC-VINSVRLGKNKETGEFKGYAH 306 Query: 239 VRFFELVTL 265 V F + V++ Sbjct: 307 VDFKDSVSV 315 >At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing protein low similarity to splicing factor SC35 [Arabidopsis thaliana] GI:9843653; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 43.2 bits (97), Expect = 8e-05 Identities = 19/48 (39%), Positives = 30/48 (62%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 +L V NL + T D+ +F G+V + + +DR+TR+SRG AFV + Sbjct: 58 TLYVSNLDFSLTNSDIHTLFSTFGKVARVTVLKDRHTRQSRGVAFVLY 105 Score = 26.2 bits (55), Expect = 9.8 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +1 Query: 259 DAEEALDTMDGRMLDGRELRVQMA 330 DA +A +MD ++L+GR+L V +A Sbjct: 110 DAAKAARSMDAKILNGRKLTVSIA 133 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 43.2 bits (97), Expect = 8e-05 Identities = 19/47 (40%), Positives = 30/47 (63%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L + NL ++ P D++ VF G V D++IP++ T +GFAFV+F Sbjct: 333 LIIRNLPFQAKPSDIKVVFSAVGFVWDVFIPKNFETGLPKGFAFVKF 379 Score = 32.7 bits (71), Expect = 0.11 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L Y T L F G V ++ ++ + E RGFAFV+F Sbjct: 24 VSGLPYSITNAQLEEAFSEVGPVRRCFLVTNKGSDEHRGFAFVKF 68 Score = 31.5 bits (68), Expect = 0.26 Identities = 15/48 (31%), Positives = 27/48 (56%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 +L + NL + T E++++ F GEV + + + T+ G AFV+F Sbjct: 562 TLFIRNLPFDVTKEEVKQRFTVFGEVESLSLVLHKVTKRPEGTAFVKF 609 >At5g51120.1 68418.m06339 polyadenylate-binding protein, putative / PABP, putative contains similarity to poly(A)-binding protein II [Mus musculus] GI:2351846; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 227 Score = 42.7 bits (96), Expect = 1e-04 Identities = 19/51 (37%), Positives = 33/51 (64%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFEL 256 S+ V N+ Y TPE++++ F+ CG V + I D++ + +GFA+V F E+ Sbjct: 104 SIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKF-GQPKGFAYVEFVEV 153 >At5g65260.1 68418.m08209 polyadenylate-binding protein family protein / PABP family protein low similarity to poly(A)-binding protein II [Drosophila melanogaster] GI:6007612; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 220 Score = 41.5 bits (93), Expect = 2e-04 Identities = 19/56 (33%), Positives = 36/56 (64%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVTLKK 271 S+ V N+ Y TPE++++ F+ CG V + I D++ + +GFA+V F E+ +++ Sbjct: 93 SVFVGNVDYACTPEEVQQHFQTCGTVHRVTILTDKF-GQPKGFAYVEFVEVEAVQE 147 >At5g10350.2 68418.m01201 polyadenylate-binding protein family protein / PABP family protein contains weak similarity to poly(A) binding protein II from [Mus musculus] GI:2351846, [Xenopus laevis] GI:11527140; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 41.5 bits (93), Expect = 2e-04 Identities = 19/56 (33%), Positives = 35/56 (62%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVTLKK 271 S+ V N+ Y TPE+++ F+ CG V + I D++ + +GFA+V F E+ +++ Sbjct: 90 SVYVGNVDYACTPEEVQLHFQTCGTVNRVTILMDKF-GQPKGFAYVEFVEVEAVQE 144 >At5g10350.1 68418.m01200 polyadenylate-binding protein family protein / PABP family protein contains weak similarity to poly(A) binding protein II from [Mus musculus] GI:2351846, [Xenopus laevis] GI:11527140; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 217 Score = 41.5 bits (93), Expect = 2e-04 Identities = 19/56 (33%), Positives = 35/56 (62%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVTLKK 271 S+ V N+ Y TPE+++ F+ CG V + I D++ + +GFA+V F E+ +++ Sbjct: 90 SVYVGNVDYACTPEEVQLHFQTCGTVNRVTILMDKF-GQPKGFAYVEFVEVEAVQE 144 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 41.5 bits (93), Expect = 2e-04 Identities = 21/45 (46%), Positives = 26/45 (57%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L + T EDL+R F + G+V D I DR + SRGF FV F Sbjct: 10 VGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTF 54 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 41.5 bits (93), Expect = 2e-04 Identities = 21/45 (46%), Positives = 26/45 (57%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L + T EDL+R F + G+V D I DR + SRGF FV F Sbjct: 10 VGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTF 54 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 41.5 bits (93), Expect = 2e-04 Identities = 21/45 (46%), Positives = 26/45 (57%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L + T EDL+R F + G+V D I DR + SRGF FV F Sbjct: 10 VGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTF 54 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 41.5 bits (93), Expect = 2e-04 Identities = 21/45 (46%), Positives = 26/45 (57%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L + T EDL+R F + G+V D I DR + SRGF FV F Sbjct: 10 VGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTF 54 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 41.5 bits (93), Expect = 2e-04 Identities = 24/58 (41%), Positives = 31/58 (53%) Frame = +2 Query: 83 PRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFEL 256 P G L V NL + +DLR+VFE G V + +PRD T +GF FV+F L Sbjct: 279 PYSGGARRLYVGNLHINMSEDDLRKVFESFGSVELVQVPRDE-TGLCKGFGFVQFARL 335 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 41.5 bits (93), Expect = 2e-04 Identities = 22/63 (34%), Positives = 34/63 (53%) Frame = +2 Query: 65 SYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVR 244 SY R P + V L + T +++RR FE+ GE+ + I D+ T +S+G+ FV Sbjct: 5 SYYRSPFGDTTYTKVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGKSKGYGFVT 64 Query: 245 FFE 253 F E Sbjct: 65 FRE 67 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 41.5 bits (93), Expect = 2e-04 Identities = 22/63 (34%), Positives = 34/63 (53%) Frame = +2 Query: 65 SYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVR 244 SY R P + V L + T +++RR FE+ GE+ + I D+ T +S+G+ FV Sbjct: 5 SYYRSPFGDTTYTKVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGKSKGYGFVT 64 Query: 245 FFE 253 F E Sbjct: 65 FRE 67 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 41.1 bits (92), Expect = 3e-04 Identities = 16/33 (48%), Positives = 24/33 (72%) Frame = +2 Query: 143 EDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 ++LR F +CGEV +++P DR T SRGFA++ Sbjct: 497 KELRSHFSKCGEVTRVHVPTDRETGASRGFAYI 529 Score = 26.2 bits (55), Expect = 9.8 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 95 GMVSLKVDNLTYRTTPEDLRRVFERCGEVGDI 190 G +L NL+Y+ D+ F+ GEV D+ Sbjct: 382 GSKTLFAGNLSYQIARSDIENFFKEAGEVVDV 413 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 40.7 bits (91), Expect = 4e-04 Identities = 20/45 (44%), Positives = 25/45 (55%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 L V NL Y T +L ++F G V D+ I D+ T SRGF FV Sbjct: 118 LYVGNLPYTITSSELSQIFGEAGTVVDVQIVYDKVTDRSRGFGFV 162 >At2g47310.1 68415.m05906 flowering time control protein-related / FCA gamma-related Length = 512 Score = 40.7 bits (91), Expect = 4e-04 Identities = 18/53 (33%), Positives = 33/53 (62%), Gaps = 1/53 (1%) Frame = +2 Query: 92 DGMVS-LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 DG ++ L V ++ T D+R+VFE+ G V +I +P+D+ T E + F+++ Sbjct: 106 DGSIAKLYVAPISKTATEYDIRQVFEKYGNVTEIILPKDKMTGERAAYCFIKY 158 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 40.7 bits (91), Expect = 4e-04 Identities = 22/45 (48%), Positives = 25/45 (55%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V ++Y T LR F + GEV D I DR T SRGFAFV F Sbjct: 38 VGGISYSTDEFGLREAFSKYGEVVDAKIIVDRETGRSRGFAFVTF 82 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 40.3 bits (90), Expect = 6e-04 Identities = 18/47 (38%), Positives = 27/47 (57%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L + L++ TT + L F +CG+V + I DR + S+GF FV F Sbjct: 36 LFIGGLSFCTTEQGLSEAFSKCGQVVEAQIVMDRVSDRSKGFGFVTF 82 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 40.3 bits (90), Expect = 6e-04 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 1/68 (1%) Frame = +2 Query: 47 SILLKMSYGRPPPRIDG-MVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRES 223 S L S PP G L V L++RTT + LR FE+ G + + + D+ Sbjct: 58 SCLSTDSSSSPPSSSSGPKTKLYVSGLSFRTTEDTLRDTFEQFGNLIHMNMVMDKVANRP 117 Query: 224 RGFAFVRF 247 +GFAF+R+ Sbjct: 118 KGFAFLRY 125 >At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing protein low similarity to heterogeneous nuclear ribonucleoprotein G [Mus musculus] GI:5579009; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 152 Score = 39.5 bits (88), Expect = 0.001 Identities = 15/47 (31%), Positives = 30/47 (63%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 + V NL + T+ + L+R F GE+ ++ + +D + S+G+AF++F Sbjct: 42 IMVRNLPFSTSEDFLKREFSAFGEIAEVKLIKDEAMKRSKGYAFIQF 88 >At3g11400.1 68416.m01390 eukaryotic translation initiation factor 3G / eIF3g nearly identical to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751 Length = 294 Score = 39.5 bits (88), Expect = 0.001 Identities = 20/48 (41%), Positives = 27/48 (56%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 S++V NL+ T DL +F G V +Y+ D+ T SRGF FV F Sbjct: 214 SVRVTNLSEDTREPDLMELFHPFGAVTRVYVAIDQKTGVSRGFGFVNF 261 >At5g44200.1 68418.m05408 nuclear cap-binding protein, putative similar to SP|P52298 20 kDa nuclear cap binding protein (CBP20) (NCBP interacting protein 1) {Homo sapiens}; non-consensus AT donor splice site at exon 4, AC acceptor splice site at exon 5; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 257 Score = 39.1 bits (87), Expect = 0.001 Identities = 17/46 (36%), Positives = 27/46 (58%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFF 250 + N+++ TT E L +F R GE+ I + D+ T+ GF FV F+ Sbjct: 38 IGNVSFYTTEEQLYELFSRAGEIKKIIMGLDKNTKTPCGFCFVLFY 83 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 39.1 bits (87), Expect = 0.001 Identities = 18/47 (38%), Positives = 30/47 (63%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L V +L + T +++ +F + G V D+Y+ RD Y R+SRG FV++ Sbjct: 213 LFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEY-RQSRGCGFVKY 258 Score = 32.7 bits (71), Expect = 0.11 Identities = 15/49 (30%), Positives = 29/49 (59%) Frame = +2 Query: 101 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L V ++ T E++R FE+ G V ++ + +D+ T + +G FV++ Sbjct: 120 VKLFVGSVPRTATEEEIRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKY 168 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 39.1 bits (87), Expect = 0.001 Identities = 18/47 (38%), Positives = 30/47 (63%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L V +L + T +++ +F + G V D+Y+ RD Y R+SRG FV++ Sbjct: 213 LFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEY-RQSRGCGFVKY 258 Score = 32.7 bits (71), Expect = 0.11 Identities = 15/49 (30%), Positives = 29/49 (59%) Frame = +2 Query: 101 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L V ++ T E++R FE+ G V ++ + +D+ T + +G FV++ Sbjct: 120 VKLFVGSVPRTATEEEIRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKY 168 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 39.1 bits (87), Expect = 0.001 Identities = 19/53 (35%), Positives = 33/53 (62%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVTLKK 271 V +L + EDL++VF GEV ++ I ++ T++S+G AF+RF + K+ Sbjct: 218 VGSLDKGASEEDLKKVFGHVGEVTEVRILKNPQTKKSKGSAFLRFATVEQAKR 270 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 39.1 bits (87), Expect = 0.001 Identities = 20/61 (32%), Positives = 33/61 (54%) Frame = +2 Query: 65 SYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVR 244 SY R P + V L + T +++RR F++ GE+ + I D+ T +S+G+ FV Sbjct: 5 SYYRSPFGDTTHTKVFVGGLAWETPTDEMRRYFDQFGEILEAVIITDKATGKSKGYGFVT 64 Query: 245 F 247 F Sbjct: 65 F 65 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 38.7 bits (86), Expect = 0.002 Identities = 18/50 (36%), Positives = 29/50 (58%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFEL 256 L V NL + + LR++FE G V + +P D T + +GF F++F +L Sbjct: 267 LYVGNLHFNMSELQLRQIFEAFGPVELVQLPLDPETGQCKGFGFIQFVQL 316 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 38.7 bits (86), Expect = 0.002 Identities = 19/45 (42%), Positives = 24/45 (53%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L+ T DL R F R G++ D I +R T SRGF F+ F Sbjct: 11 VGGLSPEVTDRDLERAFSRFGDILDCQIMLERDTGRSRGFGFITF 55 >At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing protein similar to GB:L02953 from [Xenopus laevis] (Nucleic Acids Res. 21, 999-1006 (1993)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 369 Score = 38.7 bits (86), Expect = 0.002 Identities = 21/55 (38%), Positives = 27/55 (49%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVTLKK 271 L V +++ TT E F + GEV D I DR T RGF FV F + +K Sbjct: 68 LFVGGVSWETTAETFANYFGKFGEVVDSVIMTDRITGNPRGFGFVTFADSAVAEK 122 Score = 27.5 bits (58), Expect = 4.2 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 143 EDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 ++L+ F G++ + I D +T SRGF FV F Sbjct: 171 DELKNYFCVYGDIIEHQIMYDHHTGRSRGFGFVTF 205 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 38.3 bits (85), Expect = 0.002 Identities = 19/47 (40%), Positives = 24/47 (51%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L + + Y + LR F + GEV D + DR T SRGF FV F Sbjct: 42 LFIGGMAYSMDEDSLREAFTKYGEVVDTRVILDRETGRSRGFGFVTF 88 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 38.3 bits (85), Expect = 0.002 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = +2 Query: 98 MVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 + + V L + T + +RR FE+ GE+ + + D+ T S+G+ FV F E Sbjct: 21 LTKIFVGGLAWETQRDTMRRYFEQFGEIVEAVVITDKNTGRSKGYGFVTFKE 72 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 38.3 bits (85), Expect = 0.002 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L+ TT E+ + FER G D+ + D T RGF FV + Sbjct: 124 VGGLSSNTTEEEFKSYFERFGRTTDVVVMHDGVTNRPRGFGFVTY 168 Score = 36.3 bits (80), Expect = 0.009 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L V + T+ E L++ F R G V + + +++ T + RGF FVRF Sbjct: 8 LFVGGIAKETSEEALKQYFSRYGAVLEAVVAKEKVTGKPRGFGFVRF 54 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 37.9 bits (84), Expect = 0.003 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V + + T DL VF + GE+ D+ + RD+ T +S+GFAF+ + Sbjct: 40 VGGIPFDLTEGDLLAVFSQYGEIVDVNLIRDKGTGKSKGFAFLAY 84 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 37.9 bits (84), Expect = 0.003 Identities = 26/84 (30%), Positives = 40/84 (47%), Gaps = 6/84 (7%) Frame = +2 Query: 8 NIVLFNLFDLS*ISILLKMSYG-RPPPRIDGMV-----SLKVDNLTYRTTPEDLRRVFER 169 NI++ NL + LK+++ +P P + + L V NL++ T E L F Sbjct: 140 NIIIDNLDGTEYLGRALKVNFADKPKPNKEPLYPETEHKLFVGNLSWTVTSESLAGAFRE 199 Query: 170 CGEVGDIYIPRDRYTRESRGFAFV 241 CG+V + D T SRG+ FV Sbjct: 200 CGDVVGARVVFDGDTGRSRGYGFV 223 Score = 27.5 bits (58), Expect = 4.2 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +1 Query: 259 DAEEALDTMDGRMLDGRELRVQMA 330 + E AL+++DG L+GR +RV +A Sbjct: 230 EMETALESLDGFELEGRAIRVNLA 253 >At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch domain-containing protein / RNA recognition motif (RRM)-containing protein KIAA0122 gene , Homo sapiens, EMBL:HSDKG02; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF01585: G-patch domain, weak hit to PF00641: Zn-finger in Ran binding protein and others Length = 1105 Score = 37.5 bits (83), Expect = 0.004 Identities = 19/50 (38%), Positives = 27/50 (54%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFEL 256 L V L E LR F + + D+ + RD++T SRGFAFV F+ + Sbjct: 460 LVVRGLDEDADEEMLRYEFSKHAPIKDLRLVRDKFTHVSRGFAFVHFYSV 509 Score = 33.1 bits (72), Expect = 0.085 Identities = 15/45 (33%), Positives = 27/45 (60%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L+ ++T EDL ++ G + + + R++ + SRGFAF+ F Sbjct: 302 VKGLSMKSTEEDLYQILAEWGPLHHVRVIREQNSGISRGFAFIDF 346 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 37.1 bits (82), Expect = 0.005 Identities = 21/57 (36%), Positives = 27/57 (47%) Frame = +2 Query: 74 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVR 244 R P D + V NL + L R+F G+V D + DR T SRGF FV+ Sbjct: 198 RQPRVYDAAFRIYVGNLPWDVDSGRLERLFSEHGKVVDARVVSDRETGRSRGFGFVQ 254 Score = 31.5 bits (68), Expect = 0.26 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 L V NL Y + L +FE+ G V + +R T +SRGF FV Sbjct: 115 LFVGNLPYDVDSQALAMLFEQAGTVEISEVIYNRDTDQSRGFGFV 159 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 37.1 bits (82), Expect = 0.005 Identities = 19/61 (31%), Positives = 30/61 (49%) Frame = +2 Query: 89 IDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVTLK 268 +D + V L TT + + F + GE+ D I +DR T + RGF FV + + + Sbjct: 38 VDSAGKIFVGGLARETTSAEFLKHFGKYGEITDSVIMKDRKTGQPRGFGFVTYADSSVVD 97 Query: 269 K 271 K Sbjct: 98 K 98 Score = 29.5 bits (63), Expect = 1.1 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 143 EDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 ++ + F + GE+ + I RD T SRGF FV + Sbjct: 144 DEFKEFFMQFGELKEHQIMRDHSTGRSRGFGFVTY 178 >At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 141 Score = 37.1 bits (82), Expect = 0.005 Identities = 20/51 (39%), Positives = 28/51 (54%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFEL 256 +L V L+ R T +DL F + G+V ++ + TR SRGFAFV L Sbjct: 73 TLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMSSL 123 >At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 140 Score = 37.1 bits (82), Expect = 0.005 Identities = 20/51 (39%), Positives = 28/51 (54%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFEL 256 +L V L+ R T +DL F + G+V ++ + TR SRGFAFV L Sbjct: 72 TLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMSSL 122 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 36.7 bits (81), Expect = 0.007 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L + T E LR+ FE+ GE+ + + D+ T S+G+ FV F Sbjct: 28 VGGLAWETQSETLRQHFEQYGEILEAVVIADKNTGRSKGYGFVTF 72 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 36.7 bits (81), Expect = 0.007 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +2 Query: 149 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 LR F CGE+ ++ +P DR T S+G A++ F E Sbjct: 421 LREHFSSCGEIKNVSVPIDRDTGNSKGIAYLEFSE 455 Score = 32.3 bits (70), Expect = 0.15 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = +2 Query: 83 PRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 P G +L NL++ D+ F+ GEV D+ +R RGF V F Sbjct: 291 PAAGGSKTLFAANLSFNIERADVENFFKEAGEVVDVRFSTNRDDGSFRGFGHVEF 345 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 36.3 bits (80), Expect = 0.009 Identities = 18/47 (38%), Positives = 26/47 (55%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L + +++ T E LR F G+V + I RDR T +RGF F+ F Sbjct: 8 LFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVF 54 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 36.3 bits (80), Expect = 0.009 Identities = 18/47 (38%), Positives = 26/47 (55%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L + +++ T E LR F G+V + I RDR T +RGF F+ F Sbjct: 8 LFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVF 54 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 36.3 bits (80), Expect = 0.009 Identities = 18/47 (38%), Positives = 26/47 (55%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L + +++ T E LR F G+V + I RDR T +RGF F+ F Sbjct: 8 LFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVF 54 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 36.3 bits (80), Expect = 0.009 Identities = 18/47 (38%), Positives = 27/47 (57%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L + +++ T+ + LR F GEV + I +DR T +RGF FV F Sbjct: 8 LFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDRATGRARGFGFVVF 54 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 36.3 bits (80), Expect = 0.009 Identities = 18/47 (38%), Positives = 27/47 (57%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L + +++ T+ + LR F GEV + I +DR T +RGF FV F Sbjct: 8 LFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDRATGRARGFGFVVF 54 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 36.3 bits (80), Expect = 0.009 Identities = 18/47 (38%), Positives = 24/47 (51%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L V +++ T + LR F GEV + RD+ T RGF FV F Sbjct: 8 LFVGGISWETDEDKLREHFTNYGEVSQAIVMRDKLTGRPRGFGFVIF 54 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 36.3 bits (80), Expect = 0.009 Identities = 15/35 (42%), Positives = 25/35 (71%) Frame = +2 Query: 143 EDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 EDLR + E GE+ ++ + +DR + +S+G+AFV F Sbjct: 130 EDLRDLCEEIGEIFEVRLMKDRDSGDSKGYAFVAF 164 Score = 31.5 bits (68), Expect = 0.26 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 +L V N+ T+ E L+ +F+R GEV I P + + R F FV + E Sbjct: 293 ALYVKNIPENTSTEQLKELFQRHGEVTKIVTPPGKGGK--RDFGFVHYAE 340 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 36.3 bits (80), Expect = 0.009 Identities = 19/47 (40%), Positives = 25/47 (53%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L V L++ T L++ F GEV + + DR T SRGF FV F Sbjct: 37 LFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFVSF 83 Score = 28.3 bits (60), Expect = 2.4 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 Query: 262 AEEALDTMDGRMLDGRELRVQMA 330 A A+ MDG+ L+GR++RV +A Sbjct: 89 ANNAIKEMDGKELNGRQIRVNLA 111 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 36.3 bits (80), Expect = 0.009 Identities = 19/47 (40%), Positives = 25/47 (53%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L V L++ T L++ F GEV + + DR T SRGF FV F Sbjct: 37 LFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFVSF 83 Score = 28.3 bits (60), Expect = 2.4 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 Query: 262 AEEALDTMDGRMLDGRELRVQMA 330 A A+ MDG+ L+GR++RV +A Sbjct: 89 ANNAIKEMDGKELNGRQIRVNLA 111 >At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 374 Score = 36.3 bits (80), Expect = 0.009 Identities = 15/47 (31%), Positives = 30/47 (63%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L + L++ T+ + LR FE GE+ ++ I D+ ++ S+G+AF+ + Sbjct: 284 LFITGLSFYTSEKTLRAAFEGFGELVEVKIIMDKISKRSKGYAFLEY 330 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 35.9 bits (79), Expect = 0.012 Identities = 19/45 (42%), Positives = 23/45 (51%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L + T + + R F GEV D I DR T S+GF FV F Sbjct: 48 VGGLAWATDEQSIERCFNEFGEVFDSKIIIDRETGRSKGFRFVTF 92 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 35.9 bits (79), Expect = 0.012 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L + T E LRR F++ G++ + + D+ T S+G+ FV F Sbjct: 28 VGGLAWETQSETLRRHFDQYGDILEAVVITDKNTGRSKGYGFVTF 72 >At5g06000.1 68418.m00665 eukaryotic translation initiation factor 3G, putative / eIF3g, putative similar to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 276 Score = 35.5 bits (78), Expect = 0.016 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 S++V NL+ T DL +F G V ++ D+ T SRGF FV F Sbjct: 175 SVRVTNLSEDTRGPDLMELFRPFGAVTRCHVAIDQKTSMSRGFGFVSF 222 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 35.5 bits (78), Expect = 0.016 Identities = 19/47 (40%), Positives = 24/47 (51%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L + L++ T LR F G+V D + DR T SRGF FV F Sbjct: 37 LFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNF 83 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 35.5 bits (78), Expect = 0.016 Identities = 19/47 (40%), Positives = 24/47 (51%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L + L++ T LR F G+V D + DR T SRGF FV F Sbjct: 37 LFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNF 83 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 35.5 bits (78), Expect = 0.016 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 + L + T+ LR FE+ G + + + D+++ SRGF F+ F E Sbjct: 11 IGGLAWTTSDRGLRDAFEKYGHLVEAKVVLDKFSGRSRGFGFITFDE 57 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 35.5 bits (78), Expect = 0.016 Identities = 18/47 (38%), Positives = 26/47 (55%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L + +++ T E L+ F GEV + I +DR T +RGF FV F Sbjct: 8 LFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVF 54 Score = 32.3 bits (70), Expect = 0.15 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L T D + FE+ G D+ + D T+ RGF F+ + Sbjct: 112 VGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITY 156 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 35.5 bits (78), Expect = 0.016 Identities = 18/47 (38%), Positives = 26/47 (55%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L + +++ T E L+ F GEV + I +DR T +RGF FV F Sbjct: 8 LFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVF 54 Score = 32.3 bits (70), Expect = 0.15 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L T D + FE+ G D+ + D T+ RGF F+ + Sbjct: 112 VGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITY 156 >At4g10110.1 68417.m01654 RNA recognition motif (RRM)-containing protein contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 173 Score = 35.1 bits (77), Expect = 0.021 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 + N+ R + L + + G V D++IPRD+ T + +GFAF + Sbjct: 11 IGNVDERVSDRVLYDIMIQAGRVIDLHIPRDKETDKPKGFAFAEY 55 >At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 358 Score = 35.1 bits (77), Expect = 0.021 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +2 Query: 134 TTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 TT + F + GE+ D I RDR+T + RGF F+ F Sbjct: 30 TTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITF 67 Score = 32.3 bits (70), Expect = 0.15 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V + T ++L+ F + G V + + RD T SRGF FV F Sbjct: 113 VGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIF 157 >At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 231 Score = 35.1 bits (77), Expect = 0.021 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +2 Query: 134 TTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 TT + F + GE+ D I RDR+T + RGF F+ F Sbjct: 30 TTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITF 67 Score = 32.3 bits (70), Expect = 0.15 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V + T ++L+ F + G V + + RD T SRGF FV F Sbjct: 113 VGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIF 157 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 35.1 bits (77), Expect = 0.021 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 L + L++ + L+ F GEV ++ I D+ + SRGF FV F E Sbjct: 43 LFIGGLSWSVDEQSLKDAFSSFGEVAEVRIAYDKGSGRSRGFGFVDFAE 91 Score = 27.1 bits (57), Expect = 5.6 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +1 Query: 259 DAEEALDTMDGRMLDGRELRVQMA 330 DA A D MDG+ L GR LR+ A Sbjct: 94 DALSAKDAMDGKGLLGRPLRISFA 117 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 35.1 bits (77), Expect = 0.021 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L + TT E+L+ FE GE+ + + D+ T ++GF FV F Sbjct: 167 VRGLGWDTTHENLKAAFEVYGEITECSVVMDKDTGRAKGFGFVLF 211 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 35.1 bits (77), Expect = 0.021 Identities = 18/45 (40%), Positives = 26/45 (57%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L + TT E L VFE GE+ + + D+ T +++GF FV F Sbjct: 108 VYGLPWETTRETLVGVFEGYGEIEECTVVIDKATGKAKGFGFVMF 152 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 35.1 bits (77), Expect = 0.021 Identities = 18/45 (40%), Positives = 26/45 (57%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L + TT E L VFE GE+ + + D+ T +++GF FV F Sbjct: 108 VYGLPWETTRETLVGVFEGYGEIEECTVVIDKATGKAKGFGFVMF 152 >At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing protein low similarity to enhancer binding protein-1; EBP1 [Entamoeba histolytica] GI:8163877, SP|P19682 28 kDa ribonucleoprotein, chloroplast precursor (28RNP) {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 34.7 bits (76), Expect = 0.028 Identities = 17/45 (37%), Positives = 27/45 (60%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 L N+ + +TPED+R +FE+ G V DI + + R +RG F+ Sbjct: 96 LIAQNVPWTSTPEDIRSLFEKYGSVIDIEMSMHKKER-NRGLVFI 139 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 34.7 bits (76), Expect = 0.028 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +2 Query: 101 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 + L V NL++ L ++FE G V + + D+ T SRGF FV Sbjct: 99 LKLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFV 145 Score = 27.5 bits (58), Expect = 4.2 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 L V NL++ L +F G+V + + DR + S+GF FV Sbjct: 251 LYVGNLSWGVDDMALENLFNEQGKVVEARVIYDRDSGRSKGFGFV 295 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 34.7 bits (76), Expect = 0.028 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +2 Query: 101 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 + L V NL++ L ++FE G V + + D+ T SRGF FV Sbjct: 99 LKLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFV 145 Score = 27.5 bits (58), Expect = 4.2 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 L V NL++ L +F G+V + + DR + S+GF FV Sbjct: 259 LYVGNLSWGVDDMALENLFNEQGKVVEARVIYDRDSGRSKGFGFV 303 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 34.7 bits (76), Expect = 0.028 Identities = 20/52 (38%), Positives = 25/52 (48%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVTLK 268 V L + T L F + G+V D I DR T SRGF FV F + +K Sbjct: 12 VGGLAWATDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMK 63 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 34.7 bits (76), Expect = 0.028 Identities = 20/52 (38%), Positives = 25/52 (48%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVTLK 268 V L + T L F + G+V D I DR T SRGF FV F + +K Sbjct: 12 VGGLAWATDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMK 63 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 34.3 bits (75), Expect = 0.037 Identities = 16/47 (34%), Positives = 27/47 (57%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L + +++ T E L+ F + G++ + I RDR T +RGF F+ F Sbjct: 17 LFIGGISWDTDEERLQEYFGKYGDLVEAVIMRDRTTGRARGFGFIVF 63 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 33.9 bits (74), Expect = 0.049 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +2 Query: 101 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 + L V NL + L ++FE G V + + D+ T SRGF FV Sbjct: 91 LKLFVGNLPFNVDSAQLAQLFESAGNVEMVEVIYDKITGRSRGFGFV 137 Score = 27.5 bits (58), Expect = 4.2 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +1 Query: 253 ARDAEEALDTMDGRMLDGRELRVQMA 330 +++ + A+ ++DG LDGR++RV A Sbjct: 255 SQEVQNAIKSLDGADLDGRQIRVSEA 280 Score = 27.1 bits (57), Expect = 5.6 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V NL++ L +F G+V + + DR + S+GF FV + Sbjct: 208 VGNLSWGVDDMALESLFSEQGKVVEARVIYDRDSGRSKGFGFVTY 252 >At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 347 Score = 33.9 bits (74), Expect = 0.049 Identities = 15/47 (31%), Positives = 27/47 (57%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 V L + T E +++ FE+ GE+ + + D+ + S+G+ FV F E Sbjct: 17 VGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFRE 63 >At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 242 Score = 33.9 bits (74), Expect = 0.049 Identities = 15/47 (31%), Positives = 27/47 (57%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 V L + T E +++ FE+ GE+ + + D+ + S+G+ FV F E Sbjct: 17 VGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFRE 63 >At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 249 Score = 33.9 bits (74), Expect = 0.049 Identities = 15/47 (31%), Positives = 27/47 (57%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 V L + T E +++ FE+ GE+ + + D+ + S+G+ FV F E Sbjct: 17 VGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFRE 63 >At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 100 Score = 33.5 bits (73), Expect = 0.065 Identities = 20/55 (36%), Positives = 27/55 (49%) Frame = +2 Query: 92 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFEL 256 D + V L + T E L FER GE+ + D T+ S+GF FV F E+ Sbjct: 6 DRETKIYVAGLPWITRTEGLISYFERFGEIVYAKVVCDGATQRSKGFGFVTFREV 60 >At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 169 Score = 33.5 bits (73), Expect = 0.065 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L + T E L F+R GE+ + + DR T S+G+ FV F Sbjct: 17 VGGLPWTTRKEGLINFFKRFGEIIHVNVVCDRETDRSQGYGFVTF 61 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 33.1 bits (72), Expect = 0.085 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 L V NL Y + L +FE+ G V + +R T +SRGF FV Sbjct: 152 LFVGNLAYDVNSQALAMLFEQAGTVEIAEVIYNRETDQSRGFGFV 196 Score = 30.3 bits (65), Expect = 0.60 Identities = 19/66 (28%), Positives = 30/66 (45%) Frame = +2 Query: 74 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 R P + + V NL + L ++F G+V + + DR T SRGF FV + Sbjct: 235 RAPRVYEPAFRVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSD 294 Query: 254 LVTLKK 271 + L + Sbjct: 295 VDELNE 300 Score = 27.1 bits (57), Expect = 5.6 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +1 Query: 259 DAEEALDTMDGRMLDGRELRVQMA 330 + EA+ +DG+ L+GR +RV +A Sbjct: 297 ELNEAISALDGQNLEGRAIRVNVA 320 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 32.7 bits (71), Expect = 0.11 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 L + +++ T LR F GEV + + R++ T RGF FV F Sbjct: 8 LFIGGISWDTDENLLREYFSNFGEVLQVTVMREKATGRPRGFGFVAF 54 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 31.9 bits (69), Expect = 0.20 Identities = 18/61 (29%), Positives = 31/61 (50%) Frame = +2 Query: 65 SYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVR 244 +Y PP ++ V NL T E+L++ F + GEV + IP ++G+ +V+ Sbjct: 225 AYVAPPESDVTCTTISVANLDQNVTEEELKKAFSQLGEVIYVKIP------ATKGYGYVQ 278 Query: 245 F 247 F Sbjct: 279 F 279 >At2g37510.1 68415.m04600 RNA-binding protein, putative similar to SP|P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein {Zea mays}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 142 Score = 31.9 bits (69), Expect = 0.20 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVTLKK 271 L V L+ TT E L+ F G++ D + DR + S+GF FV + + +K Sbjct: 36 LFVSGLSRLTTNEKLQDAFASFGQLVDARVITDRDSGRSKGFGFVTYATIEDAEK 90 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 31.9 bits (69), Expect = 0.20 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L + T LR FE+ G++ + + D+ + S+G+ FV F Sbjct: 11 VGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTF 55 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 31.9 bits (69), Expect = 0.20 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L + T LR FE+ G++ + + D+ + S+G+ FV F Sbjct: 11 VGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTF 55 >At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 300 Score = 31.5 bits (68), Expect = 0.26 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +1 Query: 241 EVFRARDAEEALDTMDGRMLDGRELRVQMA 330 E +RDAE+A+ DG LDG LRV++A Sbjct: 51 EFEHSRDAEDAIKGRDGYNLDGCRLRVELA 80 >At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing protein low similarity to poly(A) binding protein II from [Xenopus laevis] GI:11527140, [Mus musculus] GI:2351846, [Bos taurus] GI:1051125; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 537 Score = 31.5 bits (68), Expect = 0.26 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFE-RCGEVGDIYIPRDRYTRESRGFAFVRF 247 + V N+ Y E + F +CG V ++ + D TR +G AFV F Sbjct: 446 IHVTNVYYAAKKEAISMFFSSKCGAVQNVIVVTDPVTRHPKGTAFVTF 493 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 31.5 bits (68), Expect = 0.26 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L + + E L +F + G V ++Y+P+DR T + + F+ + Sbjct: 29 VGGLDAQLSEELLWELFVQAGPVVNVYVPKDRVTNLHQNYGFIEY 73 >At1g51510.1 68414.m05797 RNA-binding protein, putative similar to RNA-binding protein 8 (Ribonucleoprotein RBM8) SP:Q9Y5S9 from [Homo sapiens], RNA-binding protein Y14 [Xenopus laevis] GI:11034807; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 31.5 bits (68), Expect = 0.26 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 2/63 (3%) Frame = +2 Query: 65 SYGRPPPR--IDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAF 238 S GRP P+ ++G + L V + T ED+ F GE+ ++ + DR + +G+A Sbjct: 82 SDGRPGPQRSVEGWIIL-VSGVHEETQEEDITNAFGDFGEIKNLNLNLDRRSGYVKGYAL 140 Query: 239 VRF 247 + + Sbjct: 141 IEY 143 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 31.5 bits (68), Expect = 0.26 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +1 Query: 253 ARDAEEALDTMDGRMLDGRELRVQMA 330 ARDAE+A+ DG DG LRV++A Sbjct: 55 ARDAEDAIHGRDGYDFDGHRLRVELA 80 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 31.5 bits (68), Expect = 0.26 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +1 Query: 253 ARDAEEALDTMDGRMLDGRELRVQMA 330 ARDAE+A+ DG DG LRV++A Sbjct: 55 ARDAEDAIHGRDGYDFDGHRLRVELA 80 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 31.5 bits (68), Expect = 0.26 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +1 Query: 253 ARDAEEALDTMDGRMLDGRELRVQMA 330 ARDAE+A+ DG DG LRV++A Sbjct: 55 ARDAEDAIHGRDGYDFDGHRLRVELA 80 >At4g28490.1 68417.m04076 leucine-rich repeat transmembrane protein kinase, putative Length = 999 Score = 31.1 bits (67), Expect = 0.34 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 1/82 (1%) Frame = +2 Query: 32 DLS*ISILLKMSYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRY 211 D+ +ILL YG ++ KV ++ TPE + + CG + Y+ R Sbjct: 819 DVKSSNILLDSDYGA---KVADFGIAKVGQMSGSKTPEAMSGIAGSCGYIAPEYVYTLRV 875 Query: 212 TRESRGFAF-VRFFELVTLKKP 274 +S ++F V ELVT K+P Sbjct: 876 NEKSDIYSFGVVLLELVTGKQP 897 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 31.1 bits (67), Expect = 0.34 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L++ T L F+R G++ + I R T RGF F+ F Sbjct: 16 VGGLSWDVTERQLESTFDRYGKITECQIMVGRDTGRPRGFGFITF 60 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 31.1 bits (67), Expect = 0.34 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L++ T L F+R G++ + I R T RGF F+ F Sbjct: 16 VGGLSWDVTERQLESTFDRYGKITECQIMVGRDTGRPRGFGFITF 60 >At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing protein Length = 116 Score = 30.7 bits (66), Expect = 0.46 Identities = 14/48 (29%), Positives = 27/48 (56%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 +L V +++ +T E L + F + G+V + + D+ +GFA+V F Sbjct: 22 TLFVKGISFSSTEETLTQAFSQYGQVLKVDVIMDKIRCRPKGFAYVTF 69 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 30.7 bits (66), Expect = 0.46 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V NL T DL+R+F GE+ + +D +SR F FV F Sbjct: 123 VKNLVETATDADLKRLFGEFGEITSAVVMKDG-EGKSRRFGFVNF 166 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 30.3 bits (65), Expect = 0.60 Identities = 16/56 (28%), Positives = 28/56 (50%) Frame = +2 Query: 89 IDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFEL 256 ++G + V L Y T +R + E G + + +DR T S+G+AF + +L Sbjct: 355 LEGPDRIFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDL 410 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 30.3 bits (65), Expect = 0.60 Identities = 16/56 (28%), Positives = 28/56 (50%) Frame = +2 Query: 89 IDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFEL 256 ++G + V L Y T +R + E G + + +DR T S+G+AF + +L Sbjct: 355 LEGPDRIFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDL 410 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 30.3 bits (65), Expect = 0.60 Identities = 16/56 (28%), Positives = 28/56 (50%) Frame = +2 Query: 89 IDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFEL 256 ++G + V L Y T +R + E G + + +DR T S+G+AF + +L Sbjct: 355 LEGPDRIFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDL 410 >At5g03580.1 68418.m00316 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein [Triticum aestivum] GI:1737492; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 101 Score = 29.9 bits (64), Expect = 0.80 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 SL + NL + + E L +F G+V + +D + ESRGFAF+ F Sbjct: 18 SLYIANLDAQVSEEMLFLMFSDFGKVIRSVLAKD-FRGESRGFAFIEF 64 >At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit GB:CAA77136 from [Nicotiana plumbaginifolia] Length = 589 Score = 29.9 bits (64), Expect = 0.80 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +2 Query: 89 IDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAF 238 ++G + V L Y T +R + E G + + +DR T S+G+AF Sbjct: 371 LEGPDRIFVGGLPYYFTEVQIRELLESFGPLRGFNLVKDRETGNSKGYAF 420 >At1g47620.1 68414.m05289 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 520 Score = 29.9 bits (64), Expect = 0.80 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +3 Query: 99 WSR*K*IILPTERR-LKTYAAFSKGAEKLVISTFPEIGTQG 218 W K I + TE++ LK +A F + EK++ + E+G+QG Sbjct: 235 WKLQKWIGIGTEKKMLKAHATFDRVCEKIIAAKREELGSQG 275 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 29.5 bits (63), Expect = 1.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +1 Query: 253 ARDAEEALDTMDGRMLDGRELRVQMA 330 ARDA++A+ DG DG LRV++A Sbjct: 55 ARDADDAIYGRDGYDFDGHHLRVELA 80 >At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 178 Score = 29.5 bits (63), Expect = 1.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +1 Query: 253 ARDAEEALDTMDGRMLDGRELRVQMA 330 ARDA++A+ DG DG LRV++A Sbjct: 55 ARDADDAIYGRDGYDFDGHHLRVELA 80 >At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 29.5 bits (63), Expect = 1.1 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVTLKK 271 V N++ P+ L F R GE+ + + D+ T +GFA + L + KK Sbjct: 231 VSNVSADIDPQKLLEFFSRFGEIEEGPLGLDKATGRPKGFALFVYRSLESAKK 283 Score = 29.1 bits (62), Expect = 1.4 Identities = 27/102 (26%), Positives = 44/102 (43%), Gaps = 8/102 (7%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELV----TLKKP-- 274 V L + T + L F++ GE+ D D+ + +S+G+ F+ F LK+P Sbjct: 132 VHGLGWDTKADSLIDAFKQYGEIEDCKCVVDKVSGQSKGYGFILFKSRSGARNALKQPQK 191 Query: 275 --WTRWTDECWTAGNFAFRWRDMVAPHRHTGVVTIAGXVQVS 394 TR T C A + +VAP +H + + VS Sbjct: 192 KIGTRMT-ACQLASIGPVQGNPVVAPAQHFNPENVQRKIYVS 232 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 29.5 bits (63), Expect = 1.1 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +1 Query: 232 RLREVFRARDAEEALDTMDGRMLDGRELRVQMA 330 R E F RDA +AL M+G+++ G+ + +Q + Sbjct: 222 RFVEFFDVRDAAKALRVMNGKVISGKPMVIQFS 254 >At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, putative Length = 506 Score = 29.5 bits (63), Expect = 1.1 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +2 Query: 134 TTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 T EDL +F R G V + RD T +S +AF+ F Sbjct: 254 TEDEDLHTIFSRFGTVVSADVIRDFKTGDSLCYAFIEF 291 >At5g59950.3 68418.m07518 RNA and export factor-binding protein, putative Length = 242 Score = 29.1 bits (62), Expect = 1.4 Identities = 19/57 (33%), Positives = 27/57 (47%) Frame = +2 Query: 71 GRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 GR I+ L + NL Y ED++ +F GE+ + DR R S+G A V Sbjct: 76 GRSSAGIETGTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRSGR-SKGTAEV 131 >At5g59950.2 68418.m07519 RNA and export factor-binding protein, putative Length = 178 Score = 29.1 bits (62), Expect = 1.4 Identities = 19/57 (33%), Positives = 27/57 (47%) Frame = +2 Query: 71 GRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 GR I+ L + NL Y ED++ +F GE+ + DR R S+G A V Sbjct: 12 GRSSAGIETGTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRSGR-SKGTAEV 67 >At5g59950.1 68418.m07517 RNA and export factor-binding protein, putative Length = 244 Score = 29.1 bits (62), Expect = 1.4 Identities = 19/57 (33%), Positives = 27/57 (47%) Frame = +2 Query: 71 GRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFV 241 GR I+ L + NL Y ED++ +F GE+ + DR R S+G A V Sbjct: 78 GRSSAGIETGTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRSGR-SKGTAEV 133 >At3g09160.1 68416.m01082 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 198 Score = 29.1 bits (62), Expect = 1.4 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +2 Query: 146 DLRRVFERCGEVGDIYIPRDR 208 +L+++F CGE+ D++IP R Sbjct: 42 ELKKLFSPCGEITDVHIPETR 62 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 29.1 bits (62), Expect = 1.4 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L+ T E L+ F G++ D + DR + SRGF FV + Sbjct: 40 VGGLSPSTDVELLKEAFGSFGKIVDAVVVLDRESGLSRGFGFVTY 84 >At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 126 Score = 28.7 bits (61), Expect = 1.8 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 SL V + + L++VF G+V ++ I + TR+S G+ +V F Sbjct: 59 SLFVKGFSDSVSEGRLKKVFSEFGQVTNVKIIANERTRQSLGYGYVWF 106 >At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 172 Score = 28.7 bits (61), Expect = 1.8 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = +2 Query: 104 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 SL V + + L++VF G+V ++ I + TR+S G+ +V F Sbjct: 78 SLFVKGFSDSVSEGRLKKVFSEFGQVTNVKIIANERTRQSLGYGYVWF 125 >At5g03480.1 68418.m00304 expressed protein ; expression supported by MPSS Length = 321 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 149 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVR 244 L + F+ CGE+ +Y+P D + AF+R Sbjct: 133 LEKHFDSCGEIRHVYVPTDYERGVLKSVAFLR 164 Score = 27.9 bits (59), Expect = 3.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 149 LRRVFERCGEVGDIYIPRD 205 L + F CGE+ IY+PRD Sbjct: 44 LTKHFASCGEITQIYVPRD 62 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/22 (50%), Positives = 18/22 (81%) Frame = +1 Query: 262 AEEALDTMDGRMLDGRELRVQM 327 A+ A+D M+GR L G++L+VQ+ Sbjct: 403 AQNAIDMMNGRHLGGKKLKVQL 424 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 28.7 bits (61), Expect = 1.8 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAF 238 + N+ T E L ++ E G V + + D+Y+ SR F F Sbjct: 80 IGNIPRTVTNEQLTKLVEEHGAVEKVQVMYDKYSGRSRRFGF 121 >At3g46020.1 68416.m04979 RNA-binding protein, putative similar to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis}; SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 102 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/24 (45%), Positives = 20/24 (83%) Frame = +1 Query: 259 DAEEALDTMDGRMLDGRELRVQMA 330 DA +AL ++DG+++DGR + V++A Sbjct: 60 DARKALKSLDGKIVDGRLIFVEVA 83 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 28.3 bits (60), Expect = 2.4 Identities = 15/61 (24%), Positives = 30/61 (49%) Frame = +2 Query: 74 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 +PP + +L + L + L +F GE+ + +DR T S+G+ FV++ + Sbjct: 471 KPPSKEYDETNLYIGFLPPMLEDDGLINLFSSFGEIVMAKVIKDRVTGLSKGYGFVKYAD 530 Query: 254 L 256 + Sbjct: 531 V 531 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 28.3 bits (60), Expect = 2.4 Identities = 15/61 (24%), Positives = 30/61 (49%) Frame = +2 Query: 74 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE 253 +PP + +L + L + L +F GE+ + +DR T S+G+ FV++ + Sbjct: 471 KPPSKEYDETNLYIGFLPPMLEDDGLINLFSSFGEIVMAKVIKDRVTGLSKGYGFVKYAD 530 Query: 254 L 256 + Sbjct: 531 V 531 >At4g08750.1 68417.m01443 RNA recognition motif (RRM)-containing protein contains Pfam domain PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 461 Score = 28.3 bits (60), Expect = 2.4 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +2 Query: 149 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFEL 256 L + F CGE+ +++PR+ T +GF + EL Sbjct: 364 LSKHFSVCGEITRVFVPRNPSTGAIKGFKAKKALEL 399 >At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 28.3 bits (60), Expect = 2.4 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L + T E L F++ GE+ D D+ + +S+G+ F+ + Sbjct: 144 VHGLGWDTKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFILY 188 Score = 26.2 bits (55), Expect = 9.8 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 232 V N+ P+ L F + GE+ + + D+YT +GF Sbjct: 249 VSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTGRPKGF 288 >At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 28.3 bits (60), Expect = 2.4 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L + T E L F++ GE+ D D+ + +S+G+ F+ + Sbjct: 144 VHGLGWDTKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFILY 188 Score = 26.2 bits (55), Expect = 9.8 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 232 V N+ P+ L F + GE+ + + D+YT +GF Sbjct: 249 VSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTGRPKGF 288 >At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 28.3 bits (60), Expect = 2.4 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V L + T E L F++ GE+ D D+ + +S+G+ F+ + Sbjct: 144 VHGLGWDTKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFILY 188 Score = 26.2 bits (55), Expect = 9.8 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 232 V N+ P+ L F + GE+ + + D+YT +GF Sbjct: 249 VSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTGRPKGF 288 >At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing protein heterogeneous nuclear ribonucleoprotein R, Homo sapiens, PIR:T02673; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 471 Score = 28.3 bits (60), Expect = 2.4 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +2 Query: 137 TPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 T DL+ GEV ++ I R++ + + +G+AFV F Sbjct: 104 TEGDLKGFCGSIGEVTEVRIMREKDSGDGKGYAFVTF 140 >At2g37150.2 68415.m04558 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 546 Score = 28.3 bits (60), Expect = 2.4 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -2 Query: 259 HELEKPHEGESSTFPCVPISGNVDITNFSAPFEN 158 H +E+PH + P S N + FSAP EN Sbjct: 76 HSVERPHYNPGVSGPSHDPSVNSTVPTFSAPHEN 109 >At2g37150.1 68415.m04557 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 546 Score = 28.3 bits (60), Expect = 2.4 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -2 Query: 259 HELEKPHEGESSTFPCVPISGNVDITNFSAPFEN 158 H +E+PH + P S N + FSAP EN Sbjct: 76 HSVERPHYNPGVSGPSHDPSVNSTVPTFSAPHEN 109 >At5g37720.1 68418.m04541 RNA and export factor-binding protein, putative transcriptional coactivator ALY, Mus musculus, EMBL:MMU89876 Length = 288 Score = 27.9 bits (59), Expect = 3.2 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +2 Query: 107 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRES 223 L V NL T ED+R +F GEV I D+ R S Sbjct: 95 LHVTNLDQGVTNEDIRELFSEIGEVERYAIHYDKNGRPS 133 >At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RSP31 (RSP31) identical to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 264 Score = 27.5 bits (58), Expect = 4.2 Identities = 18/45 (40%), Positives = 23/45 (51%) Frame = +2 Query: 113 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 247 V N Y T DL R+F++ G V DR +S G+AFV F Sbjct: 6 VGNFEYETRQSDLERLFDKYGRV-------DRVDMKS-GYAFVYF 42 >At3g49150.1 68416.m05372 F-box family protein contains F-box domain Pfam:PF00646 Length = 590 Score = 27.5 bits (58), Expect = 4.2 Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = -2 Query: 289 RPSCPGLLQRHEL--EKPHEG 233 +PSC G++QR ++ EKPH G Sbjct: 468 QPSCSGIIQRDDVHEEKPHYG 488 >At3g26120.1 68416.m03257 RNA-binding protein, putative similar to GB:AAC39463 from [Zea mays], PF00076 RNA recognition motif (2 copies) Length = 615 Score = 27.1 bits (57), Expect = 5.6 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +1 Query: 232 RLREVFRARDAEEALDTMDGRMLDGRELRVQMA 330 R E + RDA A D M+G+ + G+++ ++ + Sbjct: 252 RFVEFYDVRDAARAFDRMNGKEIGGKQVVIEFS 284 >At3g44530.1 68416.m04786 transducin family protein / WD-40 repeat family protein contains 6 (4 significant) WD-40 repeats (PF0400); nuclear protein HIRA, mouse, PIR:S68141 Length = 1051 Score = 26.6 bits (56), Expect = 7.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 275 WTRWTDECWTAGNFAFRWRDMVAP 346 W R D+C+ A NF+ W AP Sbjct: 807 WLRVADDCFPASNFSSSWNLGSAP 830 >At1g37140.1 68414.m04640 RNA-binding protein, putative similar to terminal ear1 GI:3153237 from [Zea mays] Length = 233 Score = 26.6 bits (56), Expect = 7.4 Identities = 22/90 (24%), Positives = 39/90 (43%), Gaps = 7/90 (7%) Frame = +2 Query: 77 PPPRIDGMVSLKVDNLTYRTTPEDLRRVFER-CGEVGD------IYIPRDRYTRESRGFA 235 P ++ G S+ V N+ DL R+ + C + + +Y+P D R + G+A Sbjct: 76 PENKLAGRTSVMVKNIPNCLGRMDLLRILDNHCRKHNEKSSYDFLYLPMDFGKRANLGYA 135 Query: 236 FVRFFELVTLKKPWTRWTDECWTAGNFAFR 325 FV F + ++ + + W N FR Sbjct: 136 FVNFTSSLAAERFRREFENFSW--DNIGFR 163 >At5g49290.1 68418.m06100 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 888 Score = 26.2 bits (55), Expect = 9.8 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -3 Query: 276 QGFFSVTSSKNLTKANPLLSL 214 +GFFS+ NLTK PL L Sbjct: 281 EGFFSLNPLTNLTKLKPLFQL 301 >At5g47020.1 68418.m05795 glycine-rich protein strong similarity to unknown protein (emb|CAB87688.1) Length = 1417 Score = 26.2 bits (55), Expect = 9.8 Identities = 29/95 (30%), Positives = 40/95 (42%), Gaps = 6/95 (6%) Frame = +1 Query: 61 NELRKTSATNRWHGLVKSR*SYLPND---A*RLTPRFRKVRRSW*YLHSQRSVHKGK*RI 231 NE+ T+A + W G V S S L N + + R RK+ R Y+ SQ H Sbjct: 963 NEINSTAAYDWWEGSVHSILSVLANPCAWSWKQWRRRRKIHRLQEYVKSQYD-HSCLRSC 1021 Query: 232 RLREVFRARDAEEALDTMDGRM---LDGRELRVQM 327 R R +++ D M + L G E RV M Sbjct: 1022 RSRALYKGMKVGATPDLMVAYIDFFLGGDEKRVDM 1056 >At5g06400.1 68418.m00716 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 1030 Score = 26.2 bits (55), Expect = 9.8 Identities = 13/50 (26%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Frame = +2 Query: 92 DGMVSL--KVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFA 235 D +VS+ +++ L++R PE + V +RC +V + + + ++ GF+ Sbjct: 137 DVLVSMEDRLEKLSFRFEPEIVENVLKRCFKVPHLAMRFFNWVKQKDGFS 186 >At5g03500.1 68418.m00306 transcriptional co-activator-related low similarity to transcriptional co-activator CRSP33 [Homo sapiens] GI:4220890 Length = 443 Score = 26.2 bits (55), Expect = 9.8 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 Query: 149 LRRVFERCGEVGDIYIPRD 205 L + F CG++ IY+PRD Sbjct: 227 LEKHFASCGKITHIYVPRD 245 >At4g32720.1 68417.m04657 RNA recognition motif (RRM)-containing protein RNA-binding protein LAH1, Saccharomyces cerevisiae, PIR2:B48600; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 433 Score = 26.2 bits (55), Expect = 9.8 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +2 Query: 125 TYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFELVT 262 +Y ED+ F + G+V + +P R+ ESR F+ V E T Sbjct: 124 SYDVKREDVESFFSQYGKVNSVRMP--RHVAESRIFSGVALVEFPT 167 >At3g62210.1 68416.m06989 expressed protein contains Pfam profile PF04396: Protein of unknown function, DUF537; expression supported by MPSS Length = 279 Score = 26.2 bits (55), Expect = 9.8 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 301 PTFVRPSCPGLLQRHELEK 245 P+ +RP CP ++RH EK Sbjct: 237 PSNMRPLCPNAIRRHRQEK 255 >At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 177 Score = 26.2 bits (55), Expect = 9.8 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 Query: 259 DAEEALDTMDGRMLDGRELRVQMA 330 DA A+D MDG L GR L V A Sbjct: 66 DASAAMDNMDGAELYGRVLTVNYA 89 >At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30) nearly identical to SF2/ASF-like splicing modulator Srp30 [Arabidopsis thaliana] GI:4775270 Length = 268 Score = 26.2 bits (55), Expect = 9.8 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 256 RDAEEALDTMDGRMLDGRELRVQMA 330 RDA++A+ DG DG LRV++A Sbjct: 56 RDADDAIYGRDGYDFDGCRLRVEIA 80 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,573,246 Number of Sequences: 28952 Number of extensions: 166499 Number of successful extensions: 660 Number of sequences better than 10.0: 154 Number of HSP's better than 10.0 without gapping: 575 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 660 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 702840360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -