BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0317 (640 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small... 25 1.5 U50471-1|AAA93474.1| 135|Anopheles gambiae protein ( Anopheles ... 25 2.7 >AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small GTPase protein. Length = 190 Score = 25.4 bits (53), Expect = 1.5 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 554 GLQDFTGRPGLGVFRPLPHPQSNVF 628 GL D G+ RPL +PQ++VF Sbjct: 57 GLWDTAGQEDYDRLRPLSYPQTDVF 81 >U50471-1|AAA93474.1| 135|Anopheles gambiae protein ( Anopheles gambiae putativeribosomal protein S8 mRNA, complete cds. ). Length = 135 Score = 24.6 bits (51), Expect = 2.7 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -2 Query: 261 SFVSSATLVLYCSSVRSLV-SRFCLPLSKRRRPLPGDSSILTE 136 + V +A +V+ S R S + LPL K+R G+ +L++ Sbjct: 24 TLVKNAIIVIDASPFRQWYESHYLLPLGKKRELKAGEEDVLSK 66 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 635,136 Number of Sequences: 2352 Number of extensions: 12285 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -