BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0315 (676 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 25 0.50 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 22 4.7 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 25.4 bits (53), Expect = 0.50 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = -2 Query: 246 SPAAMTLSIDSGALNTM 196 SPA ++S+DSG++NT+ Sbjct: 555 SPAIESISVDSGSINTV 571 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 22.2 bits (45), Expect = 4.7 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +2 Query: 416 KEKASVSSHLNLSKL*MICLRLPKEQLVERRRCEACNTKTRW 541 K + + LN +++ L P QL+ RCE N KT + Sbjct: 379 KYQKIANGDLNFNEVNFRILNAPVNQLIRYTRCE--NPKTNF 418 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,860 Number of Sequences: 438 Number of extensions: 3339 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -