BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0312 (580 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F10.02 |||aminopeptidase |Schizosaccharomyces pombe|chr 1||... 26 3.5 SPBC18E5.09c |||sequence orphan|Schizosaccharomyces pombe|chr 2|... 26 3.5 SPBC31E1.04 |pep12||SNARE Pep12|Schizosaccharomyces pombe|chr 2|... 26 3.5 >SPAC4F10.02 |||aminopeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 467 Score = 26.2 bits (55), Expect = 3.5 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 181 SYYINTKSKSIVDLSKGERWKGG 113 SY++ SI+ S G++WK G Sbjct: 56 SYFVTRNKSSIIAFSIGKKWKPG 78 >SPBC18E5.09c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 128 Score = 26.2 bits (55), Expect = 3.5 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +1 Query: 217 NLGSTRYVAVTGWFTFPVFFLDYEGQLWNVYCSKQLPST 333 N GS R A+T F+FP + L + V+C P T Sbjct: 8 NGGSVRSFALTTNFSFPSYDLSFNETEHGVFCYVSRPLT 46 >SPBC31E1.04 |pep12||SNARE Pep12|Schizosaccharomyces pombe|chr 2|||Manual Length = 317 Score = 26.2 bits (55), Expect = 3.5 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +1 Query: 154 FCFSYLYSNFNSFRLQHA**NNLGSTR 234 FCF ++ F+SFR Q+A NL S R Sbjct: 243 FCFLKSFAMFSSFRSQNANLYNLNSIR 269 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,955,102 Number of Sequences: 5004 Number of extensions: 36143 Number of successful extensions: 77 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 248115846 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -