BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0312 (580 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g64625.1 68414.m07326 expressed protein similar to cDNA bHLH ... 28 5.2 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 28 5.2 >At1g64625.1 68414.m07326 expressed protein similar to cDNA bHLH transcription factor (bHLH epsilon gene) GI:32563003 Length = 527 Score = 27.9 bits (59), Expect = 5.2 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +1 Query: 286 EGQLWNVYCSKQLPSTTRAPQLSMRAEL*HYHTKGKDL 399 +GQ+W + + P TR L +L +HTK DL Sbjct: 488 KGQIWAHFIVQAKPQVTRIQVLYSLVQLFQHHTKHDDL 525 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 27.9 bits (59), Expect = 5.2 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -1 Query: 79 GLSCPRSPAPAPRQTLRPRRRWP 11 GLS PR +P PR+ L PRRR P Sbjct: 225 GLS-PRRRSPLPRRGLSPRRRSP 246 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,004,882 Number of Sequences: 28952 Number of extensions: 187973 Number of successful extensions: 475 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 466 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 475 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1131744440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -