BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0302 (717 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC21D10.06c |map4||cell agglutination protein Map4|Schizosacch... 26 6.2 SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces... 25 8.2 >SPBC21D10.06c |map4||cell agglutination protein Map4|Schizosaccharomyces pombe|chr 2|||Manual Length = 948 Score = 25.8 bits (54), Expect = 6.2 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +1 Query: 445 IPHKSSIACFRYQTID 492 +P+ SS+ACF Y T D Sbjct: 116 VPYTSSVACFPYATSD 131 >SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 3131 Score = 25.4 bits (53), Expect = 8.2 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = +1 Query: 235 QYIIVLRL-GFGINKIPAKYKLTQY*HLEHFT 327 ++ +VL+L GFGI+ I KY+ Y L++FT Sbjct: 2441 KFKLVLQLKGFGISLIDKKYEEFAYATLKNFT 2472 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,821,723 Number of Sequences: 5004 Number of extensions: 56279 Number of successful extensions: 112 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -