BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0298 (676 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 27 0.41 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 26 0.95 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 25 2.9 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 5.0 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 27.5 bits (58), Expect = 0.41 Identities = 18/63 (28%), Positives = 26/63 (41%), Gaps = 4/63 (6%) Frame = +2 Query: 77 ANNDNFXEDITTDNQLNGNAENGGGDSQDHNSAEAPGRD----DDRKLFVGGLSWETTDK 244 A+N+N +G++ NG G S N + G + D R + GG ET Sbjct: 393 ASNNNTINKSNFSGAGSGSSSNGAGSSGSSNGSNGGGCNGSGADQRTHYCGGAGCETRPG 452 Query: 245 ELR 253 LR Sbjct: 453 RLR 455 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 26.2 bits (55), Expect = 0.95 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAF 336 + A G +E++NV+TDP R F + Sbjct: 2121 YNADGMVETMNVRTDPTHTFQRNFTY 2146 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 24.6 bits (51), Expect = 2.9 Identities = 12/40 (30%), Positives = 15/40 (37%) Frame = +2 Query: 80 NNDNFXEDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 199 + D DI G GGG +D + E DDD Sbjct: 1699 SEDEKDVDIIVSGSGGGGGGGGGGGEEDGSDKEEDDDDDD 1738 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 5.0 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAF 336 + A +E++NV+TDP R F + Sbjct: 2111 YNADSMVETMNVRTDPTHTFQRNFTY 2136 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 681,760 Number of Sequences: 2352 Number of extensions: 13814 Number of successful extensions: 23 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -