BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0296 (705 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC644.05c |||deoxyuridine 5'-triphosphate nucleotidohydrolase ... 79 8e-16 SPBC1861.03 |mak10||NatC N-acetyltransferase complex subunit Mak... 26 4.6 >SPAC644.05c |||deoxyuridine 5'-triphosphate nucleotidohydrolase |Schizosaccharomyces pombe|chr 1|||Manual Length = 140 Score = 78.6 bits (185), Expect = 8e-16 Identities = 37/55 (67%), Positives = 44/55 (80%) Frame = +1 Query: 508 TGLALKNFIDVGAGVIDEDYRGNVGVVLFNHSDTDFSVKKGDRIAQLICEKIYYP 672 +GLA K+ ID GAGVID DYRG+V V+LFN+SD DF +K GDRIAQLI E+I P Sbjct: 63 SGLASKHSIDTGAGVIDADYRGHVRVLLFNYSDVDFPIKVGDRIAQLILERIVNP 117 Score = 64.9 bits (151), Expect = 1e-11 Identities = 32/56 (57%), Positives = 38/56 (67%) Frame = +2 Query: 341 RLSENAFQPVRGSEKAAGIDLMSAYDYTVPARGKELVKTDLQIELPPGCYGRVAPR 508 +LSE A P +GS +AG DL +A + VP RGK LV TDL I +P G YGRVAPR Sbjct: 7 KLSEKATIPTKGSANSAGYDLYAAAECIVPRRGKVLVDTDLAIAVPEGTYGRVAPR 62 >SPBC1861.03 |mak10||NatC N-acetyltransferase complex subunit Mak10 |Schizosaccharomyces pombe|chr 2|||Manual Length = 708 Score = 26.2 bits (55), Expect = 4.6 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 112 LIYNNSSIFLSNIAYYRFCFDFKCLH 189 L+ NS S++A Y+FC DF L+ Sbjct: 328 LLILNSHTLASSLAVYQFCLDFTRLN 353 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,534,375 Number of Sequences: 5004 Number of extensions: 47461 Number of successful extensions: 105 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -