BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0296 (705 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 24 5.4 DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. 23 9.4 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 23.8 bits (49), Expect = 5.4 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 359 FQPVRGSEKAAGIDLMSAYDYTVP 430 +QPV G+ +AAG DL+ Y +P Sbjct: 388 YQPVAGNMRAAGRDLV-LQGYQIP 410 >DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. Length = 409 Score = 23.0 bits (47), Expect = 9.4 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = +1 Query: 526 NFIDVGAGVIDEDYRGNVGVVLFNHSDTDFSVKKG-DRI-AQLICEKIYYPVLQEVLICL 699 N D+GA ++ YRGN + F + D +V + DRI + + + ++Y EV + L Sbjct: 238 NSADLGAQILRLPYRGNKLAMYFILPNPDNTVNQVLDRINSASLHQALWYMEENEVNVTL 297 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 623,152 Number of Sequences: 2352 Number of extensions: 10562 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -