BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0293 (637 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 29 0.16 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 25 2.7 AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18... 23 6.1 AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. 23 8.1 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 28.7 bits (61), Expect = 0.16 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +3 Query: 369 ERVRADLHVDVGSG-SPRGPSFHCAEGWQVGPGSVHWQRARWQDPRH 506 E VR+ L V + SG S GP +G V P S +A QD RH Sbjct: 566 ESVRSPLTVSMDSGISSSGPVNRRVQGSSVSPSSFPSPQASPQDDRH 612 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 24.6 bits (51), Expect = 2.7 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 466 EPGPTCQPSAQWKLGPRGEP 407 EPGP +P GP GEP Sbjct: 629 EPGPKGEPGLLGPPGPSGEP 648 >AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18D protein. Length = 380 Score = 23.4 bits (48), Expect = 6.1 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -1 Query: 304 CCPHQLQHDRPPS 266 CCP Q D PPS Sbjct: 60 CCPQSQQLDSPPS 72 >AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. Length = 392 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 175 RTSYGDTQPRRSGCAFSNSSDQ 240 R Y +T+ GC F SSD+ Sbjct: 329 RARYNETRDEHMGCNFLISSDE 350 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 605,085 Number of Sequences: 2352 Number of extensions: 10791 Number of successful extensions: 37 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -