BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0293 (637 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 25 0.81 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 25 0.81 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 24 1.1 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 23 1.9 AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-tripho... 23 1.9 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 21 7.6 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 21 7.6 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.6 bits (51), Expect = 0.81 Identities = 14/45 (31%), Positives = 18/45 (40%) Frame = -2 Query: 636 PAPSWCNGTGALISRHERVESDDVHAEGVHPSGHLAAXXCQGQDG 502 P W G G E++ +D + PSG L Q QDG Sbjct: 1341 PTREWYKGQG------EQIRTDSTRNIQILPSGELMLSNLQSQDG 1379 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 24.6 bits (51), Expect = 0.81 Identities = 14/45 (31%), Positives = 18/45 (40%) Frame = -2 Query: 636 PAPSWCNGTGALISRHERVESDDVHAEGVHPSGHLAAXXCQGQDG 502 P W G G E++ +D + PSG L Q QDG Sbjct: 1337 PTREWYKGQG------EQIRTDSTRNIQILPSGELMLSNLQSQDG 1375 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = -3 Query: 404 TNINVQVSSHALSALAPGALITPTPFLPAESTSM 303 TN+ +++ S ++ P LPA STS+ Sbjct: 833 TNVTTTINTPTTSVISMSGTTVPITSLPASSTSI 866 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -1 Query: 295 HQLQHDRPPSASRLVQHLFGHLS 227 H HD PP S + LF H S Sbjct: 133 HLAMHDYPPLVSGALHLLFRHFS 155 >AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-triphosphate recepter protein. Length = 178 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -1 Query: 295 HQLQHDRPPSASRLVQHLFGHLS 227 H HD PP S + LF H S Sbjct: 101 HLAMHDYPPLVSGALHLLFRHFS 123 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 7.6 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +2 Query: 401 WFWLATWSQLPL 436 WFW+ ++ LPL Sbjct: 179 WFWVTPFTVLPL 190 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 7.6 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +2 Query: 401 WFWLATWSQLPL 436 WFW+ ++ LPL Sbjct: 179 WFWVTPFTVLPL 190 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,078 Number of Sequences: 438 Number of extensions: 2917 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19071468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -