BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0287 (763 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g11720.1 68417.m01870 hypothetical protein 29 2.6 At4g34830.1 68417.m04942 pentatricopeptide (PPR) repeat-containi... 29 4.5 >At4g11720.1 68417.m01870 hypothetical protein Length = 658 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 550 RYPTVPGHWNSHIHRHRSRNYQRTHCNRFIHYRGE 654 R V H + H HRH +++RTH R H+ G+ Sbjct: 564 RADVVNRHHHHHKHRHHHNHHRRTH-QRHKHHHGQ 597 >At4g34830.1 68417.m04942 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 749 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 231 RWGAQGTSVRATLAVSSCSQSARDDFA 311 ++G +GT T+AV+SCS+S DFA Sbjct: 637 KYGIRGTPEVYTIAVNSCSKSGDWDFA 663 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,886,761 Number of Sequences: 28952 Number of extensions: 354451 Number of successful extensions: 1058 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 979 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1053 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1702303248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -