BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0285 (614 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4A8.05c |myp2|myo3|myosin II heavy chain |Schizosaccharomyce... 27 2.2 SPAC23C4.07 |tht2|mug22|meiotically upregulated gene Mug22|Schiz... 26 5.0 >SPAC4A8.05c |myp2|myo3|myosin II heavy chain |Schizosaccharomyces pombe|chr 1|||Manual Length = 2104 Score = 27.1 bits (57), Expect = 2.2 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -2 Query: 193 HSNFLLISLVMHIGDFEV 140 HS FL+I+ ++HIG+ EV Sbjct: 344 HSLFLIIASILHIGNIEV 361 >SPAC23C4.07 |tht2|mug22|meiotically upregulated gene Mug22|Schizosaccharomyces pombe|chr 1|||Manual Length = 201 Score = 25.8 bits (54), Expect = 5.0 Identities = 12/58 (20%), Positives = 26/58 (44%), Gaps = 4/58 (6%) Frame = +2 Query: 5 VEHIFVSRVASVKNKLSLVMLI----CHCFRSHIISVSHNRLCDYRKLWHFKIANVHH 166 V+ +F+S ++ L M++ C F + + ++CD + W F+ +H Sbjct: 97 VKMVFMSLAKQIEQMLKFCMMVYSKLCEAFETTLKVAKEFQICDSSQEWFFQFQLGYH 154 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,131,434 Number of Sequences: 5004 Number of extensions: 37694 Number of successful extensions: 65 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 269634532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -