BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0284 (659 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 55 4e-10 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 55 4e-10 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 51 1e-08 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 27 0.10 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 2.2 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 23 2.9 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 2.9 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 2.9 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 2.9 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 9.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.0 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 55.2 bits (127), Expect = 4e-10 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 571 INEPTAAAIAYGLDKKGTGERNVLIFDLG 657 INEPTAAAIAYGLDKK ERNVLIFDLG Sbjct: 1 INEPTAAAIAYGLDKKAEKERNVLIFDLG 29 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 55.2 bits (127), Expect = 4e-10 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 571 INEPTAAAIAYGLDKKGTGERNVLIFDLG 657 INEPTAAAIAYGLDKK ERNVLIFDLG Sbjct: 1 INEPTAAAIAYGLDKKAERERNVLIFDLG 29 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 50.8 bits (116), Expect = 1e-08 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +1 Query: 571 INEPTAAAIAYGLDKKGTGERNVLIFDLG 657 INEPTAAAIAYGLDKKG E+N+L++DLG Sbjct: 1 INEPTAAAIAYGLDKKG-AEQNILVYDLG 28 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 27.5 bits (58), Expect = 0.10 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 2/62 (3%) Frame = +2 Query: 164 DHSVLCCVHRHRASHRRCRQEPGGDEPLQHIFDAKRLI--GRKFEDATVQADMKHWPFEV 337 DH + +H + SH +QEP G H F RL+ D + ADM + + Sbjct: 342 DHQAM--LHHNPMSHH-LKQEPSGFTSSNHPFSINRLLPTAESKADIKMYADMHQYGYNT 398 Query: 338 VS 343 +S Sbjct: 399 LS 400 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 23.0 bits (47), Expect = 2.2 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +2 Query: 344 DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKT 469 D KPKI+ + ED+ E+ K K T + L KT Sbjct: 241 DKDKPKIEDVGEDEDEDTKKEDKKKKKTIKEKYTEDEELNKT 282 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.6 bits (46), Expect = 2.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 116 LPAREGGDHRQRPGQQDH 169 +P R+ DHR RP + H Sbjct: 246 IPIRQCDDHRDRPPRHFH 263 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 22.6 bits (46), Expect = 2.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 526 TKDAGTISGLNVLRIINEPTAA 591 TKDAG +S + ++N+P A Sbjct: 330 TKDAGLLSYPEICTLLNDPQNA 351 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.6 bits (46), Expect = 2.9 Identities = 13/46 (28%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +3 Query: 177 YVAFTDTERLIGDAAKNQVAMNPYNTYSMP-NVSSDVSSKMLLCKP 311 Y+A T+ N + PY+TY P N + + ++M KP Sbjct: 398 YLALPKTDSSDNRILNNLLDKKPYSTYKFPTNFDALIVNEMRSEKP 443 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 22.6 bits (46), Expect = 2.9 Identities = 13/46 (28%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +3 Query: 177 YVAFTDTERLIGDAAKNQVAMNPYNTYSMP-NVSSDVSSKMLLCKP 311 Y+A T+ N + PY+TY P N + + ++M KP Sbjct: 290 YLALPKTDSSDNRILNNLLDKKPYSTYKFPTNFDALIVNEMRSEKP 335 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.0 bits (42), Expect = 9.0 Identities = 18/77 (23%), Positives = 36/77 (46%), Gaps = 1/77 (1%) Frame = -3 Query: 489 VITAFCTVLPR*ASAVSFIFVSTMELTSSGKKVLSSPLYATLILGLPPSLTTSKGQCF-M 313 +ITAF +VLP+ A +++ F L K + Y + + + ++ + C+ + Sbjct: 87 LITAFLSVLPQLAWDITYRFYGGFLLCKVVKYGQTLGPYLSSYVLMATAIDRHQAICYPL 146 Query: 312 SACTVASSNLRPMRRLA 262 + C+ S + M LA Sbjct: 147 TYCSWTSRRSKVMVYLA 163 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -2 Query: 115 TPTQEYVVPRSIPT 74 TPT + VV R+IP+ Sbjct: 15 TPTDQRVVTRTIPS 28 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,205 Number of Sequences: 336 Number of extensions: 3728 Number of successful extensions: 13 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -