BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0284 (659 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 88 2e-19 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 3.7 DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. 23 8.5 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 88.2 bits (209), Expect = 2e-19 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +1 Query: 511 SQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLG 657 SQRQATKDAG I+GLNV+RIINEPTAAA+AYGLDK GERNVLIFDLG Sbjct: 13 SQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNVLIFDLG 61 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +2 Query: 476 NAVITVPAYFN 508 +AVITVPAYFN Sbjct: 1 DAVITVPAYFN 11 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 3.7 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +2 Query: 56 NGKSTRSRNRSGYHVLLRWCLPAREGGDHR--QRPG 157 +GK RS + +++LL P REG H+ Q PG Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHKAVQLPG 1837 >DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. Length = 410 Score = 23.0 bits (47), Expect = 8.5 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +2 Query: 176 LCCVHRHRASHRRCRQEPGGDEPL 247 +CC+ R RR P D+P+ Sbjct: 322 VCCIESFRRRRRRDAFTPSKDDPI 345 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 733,277 Number of Sequences: 2352 Number of extensions: 15913 Number of successful extensions: 23 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65650335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -