BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0283 (497 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g56070.1 68414.m06438 elongation factor 2, putative / EF-2, p... 100 5e-22 At5g13650.2 68418.m01585 elongation factor family protein contai... 54 4e-08 At5g13650.1 68418.m01584 elongation factor family protein contai... 52 2e-07 At3g22980.1 68416.m02898 elongation factor Tu family protein sim... 50 7e-07 At5g08650.1 68418.m01029 GTP-binding protein LepA, putative 48 4e-06 At5g25230.1 68418.m02991 elongation factor Tu family protein tra... 44 4e-05 At4g20360.1 68417.m02971 elongation factor Tu / EF-Tu (TUFA) ide... 44 6e-05 At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-... 44 8e-05 At1g06220.2 68414.m00656 elongation factor Tu family protein sim... 43 1e-04 At1g06220.1 68414.m00655 elongation factor Tu family protein sim... 43 1e-04 At1g62750.1 68414.m07082 elongation factor Tu family protein sim... 40 0.001 At2g45030.1 68415.m05606 mitochondrial elongation factor, putati... 36 0.015 At1g45332.1 68414.m05195 mitochondrial elongation factor, putati... 36 0.015 At5g60390.1 68418.m07574 elongation factor 1-alpha / EF-1-alpha ... 32 0.19 At1g07940.1 68414.m00863 elongation factor 1-alpha / EF-1-alpha ... 32 0.19 At1g07930.1 68414.m00862 elongation factor 1-alpha / EF-1-alpha ... 32 0.19 At1g07920.1 68414.m00861 elongation factor 1-alpha / EF-1-alpha ... 32 0.19 At1g17220.1 68414.m02098 translation initiation factor IF-2, chl... 30 0.75 At5g17810.1 68418.m02088 homeobox-leucine zipper transcription f... 30 1.00 At5g10630.1 68418.m01231 elongation factor 1-alpha, putative / E... 30 1.00 At4g02930.1 68417.m00399 elongation factor Tu, putative / EF-Tu,... 30 1.00 At5g23160.1 68418.m02708 expressed protein ; expression supporte... 29 1.3 At3g03660.1 68416.m00369 homeobox-leucine zipper transcription f... 29 1.7 At4g11160.1 68417.m01808 translation initiation factor IF-2, mit... 29 2.3 At2g03260.1 68415.m00279 EXS family protein / ERD1/XPR1/SYG1 fam... 29 2.3 At3g20280.2 68416.m02570 PHD finger family protein contains Pfam... 28 3.0 At3g20280.1 68416.m02569 PHD finger family protein contains Pfam... 28 3.0 At4g05632.1 68417.m00875 hypothetical protein 27 7.0 At1g18070.1 68414.m02236 EF-1-alpha-related GTP-binding protein,... 27 7.0 At3g24390.1 68416.m03063 Ulp1 protease family protein contains P... 27 9.3 At2g19170.1 68415.m02237 subtilase family protein contains simil... 27 9.3 >At1g56070.1 68414.m06438 elongation factor 2, putative / EF-2, putative similar to ELONGATION FACTOR 2 GB:O14460 from [Schizosaccharomyces pombe] Length = 843 Score = 100 bits (240), Expect = 5e-22 Identities = 49/66 (74%), Positives = 53/66 (80%) Frame = +2 Query: 53 MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGDTRFTDTR 232 MV FT DE+R +MD K NIRNMSVIAHVDHGKSTLTDSLV+ AGIIA AGD R TDTR Sbjct: 1 MVKFTADELRRIMDYKHNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR 60 Query: 233 KDEQDR 250 DE +R Sbjct: 61 ADEAER 66 Score = 69.7 bits (163), Expect = 1e-12 Identities = 39/80 (48%), Positives = 48/80 (60%) Frame = +1 Query: 256 TIKSTAISMFFELEEKDLVFITNPDQREKSDKGFLINLIASPGHVDFSSEVTAALRVTXX 435 TIKST IS+++E+ ++ L T + +LINLI SPGHVDFSSEVTAALR+T Sbjct: 69 TIKSTGISLYYEMTDESLKSFTGA----RDGNEYLINLIDSPGHVDFSSEVTAALRITDG 124 Query: 436 XXXXXXXXXXXXXQTETVLR 495 QTETVLR Sbjct: 125 ALVVVDCIEGVCVQTETVLR 144 >At5g13650.2 68418.m01585 elongation factor family protein contains Pfam profiles: PF00009 elongation factor Tu GTP binding domain,PF00679 elongation factor G C-terminus, PF03144 elongation factor Tu domain 2 Length = 676 Score = 54.4 bits (125), Expect = 4e-08 Identities = 28/89 (31%), Positives = 51/89 (57%), Gaps = 1/89 (1%) Frame = +2 Query: 44 PSKMVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGDTRFT 223 PS +V+ + +D++ N+RN++++AHVDHGK+TL DS++ +A + + R Sbjct: 62 PSTAEPASVEVKKKQLDRRDNVRNIAIVAHVDHGKTTLVDSMLRQAKVFRDNQVMQERIM 121 Query: 224 DTRKDEQDR-CTPLNLRPSLCSSSLKRKI 307 D+ E++R T L+ S+ + K I Sbjct: 122 DSNDLERERGITILSKNTSITYKNTKVNI 150 Score = 28.7 bits (61), Expect = 2.3 Identities = 15/49 (30%), Positives = 20/49 (40%) Frame = +1 Query: 349 KGFLINLIASPGHVDFSSEVTAALRVTXXXXXXXXXXXXXXXQTETVLR 495 K +N+I +PGH DF EV L + QT VL+ Sbjct: 144 KNTKVNIIDTPGHSDFGGEVERVLNMVDGVLLVVDSVEGPMPQTRFVLK 192 >At5g13650.1 68418.m01584 elongation factor family protein contains Pfam profiles: PF00009 elongation factor Tu GTP binding domain,PF00679 elongation factor G C-terminus, PF03144 elongation factor Tu domain 2 Length = 675 Score = 52.4 bits (120), Expect = 2e-07 Identities = 25/74 (33%), Positives = 45/74 (60%), Gaps = 1/74 (1%) Frame = +2 Query: 89 MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGDTRFTDTRKDEQDR-CTPLN 265 +D++ N+RN++++AHVDHGK+TL DS++ +A + + R D+ E++R T L+ Sbjct: 76 LDRRDNVRNIAIVAHVDHGKTTLVDSMLRQAKVFRDNQVMQERIMDSNDLERERGITILS 135 Query: 266 LRPSLCSSSLKRKI 307 S+ + K I Sbjct: 136 KNTSITYKNTKVNI 149 Score = 28.7 bits (61), Expect = 2.3 Identities = 15/49 (30%), Positives = 20/49 (40%) Frame = +1 Query: 349 KGFLINLIASPGHVDFSSEVTAALRVTXXXXXXXXXXXXXXXQTETVLR 495 K +N+I +PGH DF EV L + QT VL+ Sbjct: 143 KNTKVNIIDTPGHSDFGGEVERVLNMVDGVLLVVDSVEGPMPQTRFVLK 191 >At3g22980.1 68416.m02898 elongation factor Tu family protein similar to eukaryotic translation elongation factor 2 GB:NP_001952 [Homo sapiens] Length = 1015 Score = 50.4 bits (115), Expect = 7e-07 Identities = 30/70 (42%), Positives = 42/70 (60%), Gaps = 2/70 (2%) Frame = +2 Query: 101 RNIRNMSVIAHVDHGKSTLTDSLV--SKAGIIAGARAGDTRFTDTRKDEQDRCTPLNLRP 274 R +RN+ ++AHVDHGK+TL D L+ S G++ AG RF D +EQ R + ++ Sbjct: 7 RKVRNICILAHVDHGKTTLADHLIASSGGGVLHPRLAGKLRFMDYLDEEQRRA--ITMKS 64 Query: 275 SLCSSSLKRK 304 S S SLK K Sbjct: 65 S--SISLKYK 72 Score = 39.5 bits (88), Expect = 0.001 Identities = 20/49 (40%), Positives = 26/49 (53%) Frame = +1 Query: 349 KGFLINLIASPGHVDFSSEVTAALRVTXXXXXXXXXXXXXXXQTETVLR 495 K + +NLI SPGH+DF SEV+ A R++ QT VLR Sbjct: 72 KDYSLNLIDSPGHMDFCSEVSTAARLSDGALVLVDAVEGVHIQTHAVLR 120 >At5g08650.1 68418.m01029 GTP-binding protein LepA, putative Length = 681 Score = 48.0 bits (109), Expect = 4e-06 Identities = 24/56 (42%), Positives = 33/56 (58%) Frame = +2 Query: 104 NIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGDTRFTDTRKDEQDRCTPLNLR 271 NIRN S+IAH+DHGKSTL D L+ G + R +F D E++R + L+ Sbjct: 85 NIRNFSIIAHIDHGKSTLADKLLQVTGTVQN-RDMKEQFLDNMDLERERGITIKLQ 139 Score = 34.7 bits (76), Expect = 0.035 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = +1 Query: 346 DKGFLINLIASPGHVDFSSEVTAAL 420 D F +NLI +PGHVDFS EV+ +L Sbjct: 149 DTPFCLNLIDTPGHVDFSYEVSRSL 173 >At5g25230.1 68418.m02991 elongation factor Tu family protein translation Elongation Factor 2, Schizosaccharomyces pombe, PIR:T39902 Length = 973 Score = 44.4 bits (100), Expect = 4e-05 Identities = 21/59 (35%), Positives = 35/59 (59%), Gaps = 3/59 (5%) Frame = +2 Query: 83 GMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGD---TRFTDTRKDEQDR 250 G+M +RN++++ H+ HGK+ D LV + ++ A + R+TDTR DEQ+R Sbjct: 116 GLMSNPALVRNVALVGHLQHGKTVFMDMLVEQTHRMSTFNAENDKHMRYTDTRVDEQER 174 >At4g20360.1 68417.m02971 elongation factor Tu / EF-Tu (TUFA) identical to SWISS-PROT:P17745 elongation factor Tu, chloroplast precursor (EF-Tu) [Arabidopsis thaliana] Length = 476 Score = 44.0 bits (99), Expect = 6e-05 Identities = 24/69 (34%), Positives = 35/69 (50%) Frame = +2 Query: 59 NFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGDTRFTDTRKD 238 +FTV RG ++K+ N+ I HVDHGK+TLT +L I + A D + Sbjct: 63 SFTVRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTMALASIGSSVAKKYDEIDAAPE 122 Query: 239 EQDRCTPLN 265 E+ R +N Sbjct: 123 ERARGITIN 131 >At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-binding protein GUF1 - Saccharomyces cerevisiae, PIR:S50374 Length = 661 Score = 43.6 bits (98), Expect = 8e-05 Identities = 21/46 (45%), Positives = 28/46 (60%) Frame = +2 Query: 107 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGDTRFTDTRKDEQ 244 IRN S+IAH+DHGKSTL D L+ G I G ++ D + E+ Sbjct: 66 IRNFSIIAHIDHGKSTLADRLMELTGTIKKGH-GQPQYLDKLQRER 110 Score = 38.3 bits (85), Expect = 0.003 Identities = 23/55 (41%), Positives = 35/55 (63%) Frame = +1 Query: 256 TIKSTAISMFFELEEKDLVFITNPDQREKSDKGFLINLIASPGHVDFSSEVTAAL 420 T+K+ +MF+E + +D +E S G+L+NLI +PGHVDFS EV+ +L Sbjct: 113 TVKAQTATMFYENKVED---------QEAS--GYLLNLIDTPGHVDFSYEVSRSL 156 >At1g06220.2 68414.m00656 elongation factor Tu family protein similar to Cryptosporidium parvum elongation factor-2 GB:U21667 GI:706974 from [Cryptosporidium parvum] Length = 987 Score = 43.2 bits (97), Expect = 1e-04 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 3/59 (5%) Frame = +2 Query: 83 GMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGD---TRFTDTRKDEQDR 250 G+M +RN++++ H+ HGK+ D LV + ++ A + ++TDTR DEQ+R Sbjct: 130 GLMSNPALVRNVALVGHLQHGKTVFMDMLVEQTHHMSTFNAKNEKHMKYTDTRVDEQER 188 Score = 37.5 bits (83), Expect = 0.005 Identities = 17/53 (32%), Positives = 27/53 (50%) Frame = +1 Query: 337 EKSDKGFLINLIASPGHVDFSSEVTAALRVTXXXXXXXXXXXXXXXQTETVLR 495 + K +L N++ +PGHV+FS E+TA+LR+ TE +R Sbjct: 203 DSRSKSYLCNIMDTPGHVNFSDEMTASLRLADGAVLIVDAAEGVMVNTERAIR 255 >At1g06220.1 68414.m00655 elongation factor Tu family protein similar to Cryptosporidium parvum elongation factor-2 GB:U21667 GI:706974 from [Cryptosporidium parvum] Length = 987 Score = 43.2 bits (97), Expect = 1e-04 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 3/59 (5%) Frame = +2 Query: 83 GMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGD---TRFTDTRKDEQDR 250 G+M +RN++++ H+ HGK+ D LV + ++ A + ++TDTR DEQ+R Sbjct: 130 GLMSNPALVRNVALVGHLQHGKTVFMDMLVEQTHHMSTFNAKNEKHMKYTDTRVDEQER 188 Score = 37.5 bits (83), Expect = 0.005 Identities = 17/53 (32%), Positives = 27/53 (50%) Frame = +1 Query: 337 EKSDKGFLINLIASPGHVDFSSEVTAALRVTXXXXXXXXXXXXXXXQTETVLR 495 + K +L N++ +PGHV+FS E+TA+LR+ TE +R Sbjct: 203 DSRSKSYLCNIMDTPGHVNFSDEMTASLRLADGAVLIVDAAEGVMVNTERAIR 255 >At1g62750.1 68414.m07082 elongation factor Tu family protein similar to elongation factor G SP:P34811 [Glycine max (Soybean)] Length = 783 Score = 39.9 bits (89), Expect = 0.001 Identities = 28/78 (35%), Positives = 38/78 (48%) Frame = +1 Query: 262 KSTAISMFFELEEKDLVFITNPDQREKSDKGFLINLIASPGHVDFSSEVTAALRVTXXXX 441 + TA + E E++ + IT+ DK IN+I +PGHVDF+ EV ALRV Sbjct: 131 EGTATMDWMEQEQERGITITSAATTTFWDK-HRINIIDTPGHVDFTLEVERALRVLDGAI 189 Query: 442 XXXXXXXXXXXQTETVLR 495 Q+ETV R Sbjct: 190 CLFDSVAGVEPQSETVWR 207 Score = 30.3 bits (65), Expect = 0.75 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +2 Query: 101 RNIRNMSVIAHVDHGKSTLTDSLVSKAG--IIAGARAGDTRFTDTRKDEQDR 250 ++ RN+ ++AH+D GK+T T+ ++ G G T D + EQ+R Sbjct: 94 KDYRNIGIMAHIDAGKTTTTERILYYTGRNYKIGEVHEGTATMDWMEQEQER 145 >At2g45030.1 68415.m05606 mitochondrial elongation factor, putative similar to SP|P25039 Elongation factor G 1, mitochondrial precursor (mEF-G-1) {Saccharomyces cerevisiae}; contains Pfam profiles PF00009: Elongation factor Tu GTP binding domain, PF03764: Elongation factor G domain IV, PF00679: Elongation factor G C-terminus Length = 754 Score = 35.9 bits (79), Expect = 0.015 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = +1 Query: 349 KGFLINLIASPGHVDFSSEVTAALRV 426 K + +N+I +PGHVDF+ EV ALRV Sbjct: 131 KDYKVNIIDTPGHVDFTIEVERALRV 156 Score = 31.5 bits (68), Expect = 0.33 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +2 Query: 89 MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGII 190 MDK +RN+ + AH+D GK+TLT+ ++ G I Sbjct: 62 MDK---LRNIGISAHIDSGKTTLTERVLFYTGRI 92 >At1g45332.1 68414.m05195 mitochondrial elongation factor, putative similar to mitochondrial elongation factor GI:3917 from [Saccharomyces cerevisiae] Length = 754 Score = 35.9 bits (79), Expect = 0.015 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = +1 Query: 349 KGFLINLIASPGHVDFSSEVTAALRV 426 K + +N+I +PGHVDF+ EV ALRV Sbjct: 131 KDYKVNIIDTPGHVDFTIEVERALRV 156 Score = 31.5 bits (68), Expect = 0.33 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +2 Query: 89 MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGII 190 MDK +RN+ + AH+D GK+TLT+ ++ G I Sbjct: 62 MDK---LRNIGISAHIDSGKTTLTERVLFYTGRI 92 >At5g60390.1 68418.m07574 elongation factor 1-alpha / EF-1-alpha identical to SWISS-PROT:P13905 elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana] Length = 449 Score = 32.3 bits (70), Expect = 0.19 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +2 Query: 89 MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 184 M K++ N+ VI HVD GKST T L+ K G Sbjct: 1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLG 32 >At1g07940.1 68414.m00863 elongation factor 1-alpha / EF-1-alpha identical to GB:CAA34456 from [Arabidopsis thaliana] (Plant Mol. Biol. 14 (1), 107-110 (1990)) Length = 449 Score = 32.3 bits (70), Expect = 0.19 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +2 Query: 89 MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 184 M K++ N+ VI HVD GKST T L+ K G Sbjct: 1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLG 32 >At1g07930.1 68414.m00862 elongation factor 1-alpha / EF-1-alpha identical to GB:CAA34456 from [Arabidopsis thaliana] (Plant Mol. Biol. 14 (1), 107-110 (1990)) Length = 449 Score = 32.3 bits (70), Expect = 0.19 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +2 Query: 89 MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 184 M K++ N+ VI HVD GKST T L+ K G Sbjct: 1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLG 32 >At1g07920.1 68414.m00861 elongation factor 1-alpha / EF-1-alpha identical to GB:CAA34456 from [Arabidopsis thaliana] (Plant Mol. Biol. 14 (1), 107-110 (1990)) Length = 449 Score = 32.3 bits (70), Expect = 0.19 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +2 Query: 89 MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 184 M K++ N+ VI HVD GKST T L+ K G Sbjct: 1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLG 32 >At1g17220.1 68414.m02098 translation initiation factor IF-2, chloroplast, putative similar to SP|P57997|IF2C_PHAVU Translation initiation factor IF-2, chloroplast precursor (PvIF2cp) {Phaseolus vulgaris} Length = 1026 Score = 30.3 bits (65), Expect = 0.75 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +2 Query: 116 MSVIAHVDHGKSTLTDSLVSKAGIIAGARAGDTR 217 ++++ HVDHGK+TL D + K+ + A G T+ Sbjct: 504 ITIMGHVDHGKTTLLD-YIRKSKVAASEAGGITQ 536 >At5g17810.1 68418.m02088 homeobox-leucine zipper transcription factor family protein similar to to PRESSED FLOWER (GP:17907768) {Arabidopsis thaliana}; Length = 268 Score = 29.9 bits (64), Expect = 1.00 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +3 Query: 126 SPTSITASQPSRTRWFPRPVSLLVRE 203 SP+S T+++P R RW P+P +L+ E Sbjct: 9 SPSS-TSTEPVRARWSPKPEQILILE 33 >At5g10630.1 68418.m01231 elongation factor 1-alpha, putative / EF-1-alpha, putative contains similarity to SWISS-PROT:Q9YAV0 elongation factor 1-alpha (EF-1-alpha) [Aeropyrum pernix] Length = 667 Score = 29.9 bits (64), Expect = 1.00 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +2 Query: 113 NMSVIAHVDHGKSTLTDSLVSKAGIIA 193 N++++ HVD GKSTL+ L+ G I+ Sbjct: 241 NLAIVGHVDSGKSTLSGRLLHLLGRIS 267 >At4g02930.1 68417.m00399 elongation factor Tu, putative / EF-Tu, putative similar to mitochondrial elongation factor Tu [Arabidopsis thaliana] gi|1149571|emb|CAA61511 Length = 454 Score = 29.9 bits (64), Expect = 1.00 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +2 Query: 113 NMSVIAHVDHGKSTLTDSL 169 N+ I HVDHGK+TLT ++ Sbjct: 69 NVGTIGHVDHGKTTLTAAI 87 >At5g23160.1 68418.m02708 expressed protein ; expression supported by MPSS Length = 271 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 156 SRTRWFPRPVSLLVREPETPVSLTRVRTNK 245 +RTRWF RP +E TP S+ + K Sbjct: 49 TRTRWFSRPTKFRSKEEITPTSIYKSEKQK 78 >At3g03660.1 68416.m00369 homeobox-leucine zipper transcription factor family protein similar to to PRESSED FLOWER (GP:17907768) {Arabidopsis thaliana} Length = 199 Score = 29.1 bits (62), Expect = 1.7 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +3 Query: 126 SPTSITASQPSRTRWFPRPVSLLVRE 203 S + T+++P R+RW P+P +L+ E Sbjct: 20 SASGSTSAEPVRSRWSPKPEQILILE 45 >At4g11160.1 68417.m01808 translation initiation factor IF-2, mitochondrial, putative similar to SP|P46198|IF2M_BOVIN Translation initiation factor IF-2, mitochondrial precursor (IF-2Mt) (IF-2(Mt)) {Bos taurus} Length = 743 Score = 28.7 bits (61), Expect = 2.3 Identities = 13/31 (41%), Positives = 22/31 (70%) Frame = +2 Query: 116 MSVIAHVDHGKSTLTDSLVSKAGIIAGARAG 208 ++V+ HVDHGK++L D+L + + +A AG Sbjct: 222 VTVMGHVDHGKTSLLDALRNTS--VAAREAG 250 >At2g03260.1 68415.m00279 EXS family protein / ERD1/XPR1/SYG1 family protein similar to PHO1 protein [Arabidopsis thaliana] GI:20069032; contains Pfam profiles PF03105: SPX domain, PF03124: EXS family Length = 807 Score = 28.7 bits (61), Expect = 2.3 Identities = 19/74 (25%), Positives = 31/74 (41%), Gaps = 2/74 (2%) Frame = +2 Query: 137 DHG--KSTLTDSLVSKAGIIAGARAGDTRFTDTRKDEQDRCTPLNLRPSLCSSSLKRKI* 310 DHG + D S + GAR D K + TP + + +SS + +I Sbjct: 230 DHGSVRGATGDVKTSSLNTMRGARPAPIEVLDHIKINNTKATPRSTIKGVLNSSSQNEII 289 Query: 311 YSSQTLTSVKRVIK 352 ++ Q L V+ +K Sbjct: 290 FNRQNLNEVEEKLK 303 >At3g20280.2 68416.m02570 PHD finger family protein contains Pfam profile: PF00628 PHD-finger Length = 482 Score = 28.3 bits (60), Expect = 3.0 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -1 Query: 488 TVSVCTHTPDTQSTTTRDPSVTRSAAVTSEEKS 390 T S T PD ST T PSVT+ + + EK+ Sbjct: 383 TASPATVVPDQDSTITAAPSVTQEDSAFNTEKT 415 >At3g20280.1 68416.m02569 PHD finger family protein contains Pfam profile: PF00628 PHD-finger Length = 743 Score = 28.3 bits (60), Expect = 3.0 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -1 Query: 488 TVSVCTHTPDTQSTTTRDPSVTRSAAVTSEEKS 390 T S T PD ST T PSVT+ + + EK+ Sbjct: 644 TASPATVVPDQDSTITAAPSVTQEDSAFNTEKT 676 >At4g05632.1 68417.m00875 hypothetical protein Length = 197 Score = 27.1 bits (57), Expect = 7.0 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 216 VSLTRVRTNKTVAHH*IYGHLYVLR-A*RERFSIHHK 323 VSL+R + + HH +Y HL LR + E SIH + Sbjct: 62 VSLSRTKQGSALEHHKLYMHLTKLRQSVLEASSIHDR 98 >At1g18070.1 68414.m02236 EF-1-alpha-related GTP-binding protein, putative similar to EF-1-alpha-related GTP-binding protein gi|1009232|gb|AAA79032 Length = 532 Score = 27.1 bits (57), Expect = 7.0 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +2 Query: 92 DKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 184 +KKR++ N+ I HVD GKST+ ++ +G Sbjct: 97 NKKRHL-NVVFIGHVDAGKSTIGGQILFLSG 126 >At3g24390.1 68416.m03063 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At4g08880, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At3g42730, At1g52020, At4g05280, At1g25886, At4g03300 Length = 1139 Score = 26.6 bits (56), Expect = 9.3 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = +1 Query: 241 TRPLHTIKSTAISMFFELEEKDLVFITNPDQREKSDKGFLINLIASPGHVDFSS 402 TR H + + A+S+ +E+DL PD ++ +GF+ + DF++ Sbjct: 548 TRVSHDVDTPALSVGCNSKEEDLDVPGEPDSNKEDMQGFIDEHDGANNESDFTA 601 >At2g19170.1 68415.m02237 subtilase family protein contains similarity to meiotic serine proteinase TMP GI:6468325 from [Lycopersicon esculentum] Length = 815 Score = 26.6 bits (56), Expect = 9.3 Identities = 26/123 (21%), Positives = 49/123 (39%), Gaps = 1/123 (0%) Frame = -1 Query: 449 TTTRDPSVTRSAAVTSEEKSTCPGEAIKLIKKPLSLFSRWSGFVMNTKSFSSSSK-NIEM 273 T+ P + AA+ ++ AIK S +G ++ + +S + + Sbjct: 595 TSMAAPHIAGIAALVKQKHPQWSPAAIKSALMTTSTVIDRAGRLLQAQQYSDTEAVTLVK 654 Query: 272 AVDLMVCNGLVRPYACQ*NGCLRLSHQQ*YRPWKPTSP*GLTCRDRRGRSQTCCGYSASC 93 A +G V P A G + + + Y + T+P G++ + R + T C Y Sbjct: 655 ATPFDYGSGHVNPSAALDPGLIFDAGYEDYLGFLCTTP-GISAHEIRNYTNTACNYDMKH 713 Query: 92 PSS 84 PS+ Sbjct: 714 PSN 716 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,924,622 Number of Sequences: 28952 Number of extensions: 222070 Number of successful extensions: 716 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 686 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 713 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -