BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0282 (697 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 53 8e-09 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 53 8e-09 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 53 8e-09 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 53 8e-09 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 50 5e-08 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 29 0.011 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 53.2 bits (122), Expect = 8e-09 Identities = 26/48 (54%), Positives = 32/48 (66%), Gaps = 2/48 (4%) Frame = +2 Query: 395 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGG--GPALGSLLI 532 HYT G E+VD VLD +RK + C LQGF + HS GG G +G+LLI Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLI 48 Score = 46.8 bits (106), Expect = 7e-07 Identities = 19/56 (33%), Positives = 36/56 (64%) Frame = +3 Query: 528 LLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILNTXTTLEHSDCAFMVDNE 695 LL+ ++ +Y + +++ P+P+VS VVEPYN+ L+ +E++D + +DNE Sbjct: 46 LLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNE 101 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 53.2 bits (122), Expect = 8e-09 Identities = 26/48 (54%), Positives = 32/48 (66%), Gaps = 2/48 (4%) Frame = +2 Query: 395 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGG--GPALGSLLI 532 HYT G E+VD VLD +RK + C LQGF + HS GG G +G+LLI Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLI 48 Score = 46.8 bits (106), Expect = 7e-07 Identities = 19/56 (33%), Positives = 36/56 (64%) Frame = +3 Query: 528 LLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILNTXTTLEHSDCAFMVDNE 695 LL+ ++ +Y + +++ P+P+VS VVEPYN+ L+ +E++D + +DNE Sbjct: 46 LLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNE 101 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 53.2 bits (122), Expect = 8e-09 Identities = 26/48 (54%), Positives = 32/48 (66%), Gaps = 2/48 (4%) Frame = +2 Query: 395 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGG--GPALGSLLI 532 HYT G E+VD VLD +RK + C LQGF + HS GG G +G+LLI Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLI 48 Score = 46.8 bits (106), Expect = 7e-07 Identities = 19/56 (33%), Positives = 36/56 (64%) Frame = +3 Query: 528 LLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILNTXTTLEHSDCAFMVDNE 695 LL+ ++ +Y + +++ P+P+VS VVEPYN+ L+ +E++D + +DNE Sbjct: 46 LLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNE 101 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 53.2 bits (122), Expect = 8e-09 Identities = 26/48 (54%), Positives = 32/48 (66%), Gaps = 2/48 (4%) Frame = +2 Query: 395 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGG--GPALGSLLI 532 HYT G E+VD VLD +RK + C LQGF + HS GG G +G+LLI Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLI 48 Score = 46.8 bits (106), Expect = 7e-07 Identities = 19/56 (33%), Positives = 36/56 (64%) Frame = +3 Query: 528 LLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILNTXTTLEHSDCAFMVDNE 695 LL+ ++ +Y + +++ P+P+VS VVEPYN+ L+ +E++D + +DNE Sbjct: 46 LLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNE 101 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 50.4 bits (115), Expect = 5e-08 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = +3 Query: 78 MRECISVHVGQAGVQIGNACWE 143 MRECISVHVGQAGVQIGN CW+ Sbjct: 1 MRECISVHVGQAGVQIGNPCWD 22 Score = 35.9 bits (79), Expect = 0.001 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = +1 Query: 133 PAGSFTAWSTASSLMARCPQTRPSGVETILSTLSSARPELAARTPC 270 P T WS AS+ RCP+TR S E +++ + + P LA + C Sbjct: 19 PCWDCTVWSMASNRTVRCPRTRRS--EAVMTRSTPSSPRLAQASTC 62 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 29.5 bits (63), Expect(2) = 0.011 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 184 CPQTRPSGVETILSTLSSARPELAARTPCCLR 279 C RPS ++ ++ S RP+LAA + C R Sbjct: 164 CGSARPSRIDVAFASPSICRPDLAANSATCWR 195 Score = 21.8 bits (44), Expect(2) = 0.011 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 127 VMPAGSFTAWSTASSLMARCPQTRPSGV 210 V+ AG F AW TA +T+P G+ Sbjct: 116 VLLAGDFNAWHTAWG----SERTKPKGI 139 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 767,844 Number of Sequences: 2352 Number of extensions: 16648 Number of successful extensions: 32 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -