BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0282 (697 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 26 0.30 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 25 0.52 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 25 0.52 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 2.8 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 23 3.7 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 3.7 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 3.7 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 3.7 AB264333-1|BAF44088.1| 36|Apis mellifera ecdysone-induced prot... 22 6.4 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 21 8.5 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 8.5 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 26.2 bits (55), Expect = 0.30 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -2 Query: 540 APSIRSEPRAGPPPKEWKIRNPC 472 AP + R PPP++WK + C Sbjct: 405 APFLIGSRRTSPPPEDWKPLDKC 427 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 25.4 bits (53), Expect = 0.52 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 Query: 470 LQGFLIFHSFGGGPALGSLLI 532 L+G +I HS+GGG GS ++ Sbjct: 656 LRGSIIDHSYGGGFGFGSAVL 676 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 25.4 bits (53), Expect = 0.52 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 Query: 470 LQGFLIFHSFGGGPALGSLLI 532 L+G +I HS+GGG GS ++ Sbjct: 694 LRGSIIDHSYGGGFGFGSAVL 714 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 23.0 bits (47), Expect = 2.8 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +2 Query: 233 LQRDRSWQHVPRAVFVDLEPTVVDEVRTGTYRQL 334 L+ R+ H+ + D+EPTV RQL Sbjct: 234 LEERRAQSHLEAHCYFDIEPTVQQHQPVTVNRQL 267 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -2 Query: 141 PSRHYRSGLR 112 P RHYRSGL+ Sbjct: 139 PLRHYRSGLK 148 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -2 Query: 204 RWSCLWASGHQAGCRAPGSKAPSRHYR 124 RW C W+ G C+A A SR R Sbjct: 387 RW-CTWSEGDLEKCKALTRAAYSRDVR 412 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -2 Query: 204 RWSCLWASGHQAGCRAPGSKAPSRHYR 124 RW C W+ G C+A A SR R Sbjct: 387 RW-CTWSEGDLEKCKALTRAAYSRDVR 412 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -2 Query: 204 RWSCLWASGHQAGCRAPGSKAPSRHYR 124 RW C W+ G C+A A SR R Sbjct: 387 RW-CTWSEGDLEKCKALTRAAYSRDVR 412 >AB264333-1|BAF44088.1| 36|Apis mellifera ecdysone-induced protein 75 protein. Length = 36 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 175 MARCPQTRPSGVETILSTLSSARPE 249 +A+ P + T+ ST+SSA+PE Sbjct: 7 VAQLPHHLSPNMPTMDSTVSSAKPE 31 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 487 LPLLRWRSGSGFTS 528 LPLL W G GF S Sbjct: 158 LPLLVWIYGGGFMS 171 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 487 LPLLRWRSGSGFTS 528 LPLL W G GF S Sbjct: 158 LPLLVWIYGGGFMS 171 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,908 Number of Sequences: 438 Number of extensions: 4998 Number of successful extensions: 13 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -