BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0280 (705 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 21 7.4 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 7.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.8 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.4 bits (43), Expect = 7.4 Identities = 11/37 (29%), Positives = 15/37 (40%) Frame = +3 Query: 18 APRKCPANARPKTAGSKTFESRSPKPAFVAAPXSTVF 128 AP++C + P K + KP A TVF Sbjct: 474 APKECKQDFMPHELCDKYYRCVHGKPTEFACRPGTVF 510 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 7.4 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 343 ILIIETIYNVIIVLFLTLISVLMSEFIAFVIRLYKVLVFY 462 +LI +TI+ + +++ I+ L +I V +Y VFY Sbjct: 609 LLITQTIFIICVIVQSEQIAWLHLLYIFLVGIMYAADVFY 648 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 258 VYVTFHCIKMFCLILRXXRF 317 V+VT + + +C +LR RF Sbjct: 497 VFVTTYLMFDYCTVLRVQRF 516 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 9.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 148 RSRWQVSHRHPNPCSRPGRS 207 R R V+ H N SRPG S Sbjct: 369 REREPVADHHANLYSRPGDS 388 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,640 Number of Sequences: 336 Number of extensions: 3254 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -