BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0280 (705 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 27 0.43 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 27 0.76 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 25 3.1 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 24 4.1 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 24 4.1 AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 24 5.4 X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 23 7.1 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 7.1 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 9.4 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 9.4 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 27.5 bits (58), Expect = 0.43 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Frame = +1 Query: 19 PRGSARPTRAPKPPALRLLSP-DRRNLLSWRLRXPPSSRGLNRCRSRWQVSHRHPNPCSR 195 PR PT++P P + + LSP + S+R P+S + + + Q P P R Sbjct: 441 PRPGQSPTQSPSPGSQQSLSPANTDENFSYRPGAKPNSGQQQQQQQQQQQYKLQPPPGGR 500 Query: 196 P 198 P Sbjct: 501 P 501 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 26.6 bits (56), Expect = 0.76 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = -3 Query: 196 GASRGWGADGSPAIVSGSGLAHAKTVXSGAATKAGFG 86 G+S G GS SG G+ +V +GAA AG G Sbjct: 672 GSSSLGGGGGSGRSSSGGGMIGMHSVAAGAAVAAGGG 708 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 24.6 bits (51), Expect = 3.1 Identities = 15/47 (31%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = -3 Query: 220 LNGRGNDRGASRGWGADGSPAIVSGSGL--AHAKTVXSGAATKAGFG 86 L G D+G G DG+P GL H +TV K G Sbjct: 695 LRGMKGDKGRPGEAGIDGAPGAPGKDGLPGRHGQTVKGEPGLKGNVG 741 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 11 PQGPAEVPGQRAPQNRR 61 PQGP PGQ P+ R Sbjct: 478 PQGPRGYPGQPGPEGLR 494 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 24.2 bits (50), Expect = 4.1 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 369 CHYCFIFNTYFCF 407 C +C +FN YF F Sbjct: 7 CPFCLLFNLYFLF 19 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 Query: 470 ITSLRRTLPEVIMLRYPAV 526 +T+ R T PE++ LRYP V Sbjct: 1170 MTNTRITDPEILELRYPIV 1188 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 23.8 bits (49), Expect = 5.4 Identities = 16/58 (27%), Positives = 20/58 (34%) Frame = -3 Query: 214 GRGNDRGASRGWGADGSPAIVSGSGLAHAKTVXSGAATKAGFGDRDSKVLEPAVLGRA 41 G G+D G G G G G G G+GDR+ PA G + Sbjct: 58 GGGDDGYGGGGRGGRGGRGGGRGRGRGRGGRDGGGGFGGGGYGDRNGDGGRPAYSGNS 115 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 23.4 bits (48), Expect = 7.1 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +3 Query: 132 WAKPLPLTMAGEPSAPQP 185 W +P+P PS PQP Sbjct: 523 WVQPVPSHTQNGPSQPQP 540 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.4 bits (48), Expect = 7.1 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -2 Query: 659 EVEFTVKSRPHTHVSNTANDPELI 588 E+E + SRP T +S ND E + Sbjct: 1577 EIEACLNSRPITAISEDPNDMEAL 1600 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 408 NERVYRICYSSVQSLSFLWV 467 N R+ R C +V+S +F W+ Sbjct: 471 NRRLRRACRKAVKSQAFYWL 490 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.0 bits (47), Expect = 9.4 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 208 GNDRGASRGWGADGSP 161 GNDRGA G G+ P Sbjct: 1214 GNDRGAGEGGGSRSVP 1229 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 681,436 Number of Sequences: 2352 Number of extensions: 12821 Number of successful extensions: 28 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -