BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0280 (705 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 2.1 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 6.5 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 21 8.6 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 21 8.6 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 21 8.6 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 21 8.6 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 21 8.6 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 21 8.6 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 21 8.6 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 21 8.6 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 21 8.6 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 8.6 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 8.6 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 66 KTFESRSPKPAFVAAPXSTVFAWAKPLPLTMAGEPS 173 +T S SP P +AP S+ + AG+PS Sbjct: 506 ETNSSPSPNPRIASAPSSSTSSSPPAKGAAAAGQPS 541 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.8 bits (44), Expect = 6.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 214 GRGNDRGASRGWGAD 170 GRG+ +G SRG G + Sbjct: 83 GRGHGKGGSRGRGGN 97 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +3 Query: 390 NTYFCFNERVYRICYSSVQSLSFLWVESPVFAGLCP 497 N Y +N+ Y Y ++ + + + PV+ G P Sbjct: 96 NNYNNYNKHNYNKLYYNINYIEQIPIPVPVYCGNFP 131 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +3 Query: 390 NTYFCFNERVYRICYSSVQSLSFLWVESPVFAGLCP 497 N Y +N+ Y Y ++ + + + PV+ G P Sbjct: 96 NNYNNYNKHNYNKLYYNINYIEQIPIPVPVYCGNFP 131 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +3 Query: 390 NTYFCFNERVYRICYSSVQSLSFLWVESPVFAGLCP 497 N Y +N+ Y Y ++ + + + PV+ G P Sbjct: 96 NNYNNYNKHNYNKLYYNINYIEQIPIPVPVYCGNFP 131 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +3 Query: 390 NTYFCFNERVYRICYSSVQSLSFLWVESPVFAGLCP 497 N Y +N+ Y Y ++ + + + PV+ G P Sbjct: 96 NNYNNYNKHNYNKLYYNINYIEQIPIPVPVYCGNFP 131 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +3 Query: 390 NTYFCFNERVYRICYSSVQSLSFLWVESPVFAGLCP 497 N Y +N+ Y Y ++ + + + PV+ G P Sbjct: 96 NNYNNYNKHNYNKLYYNINYIEQIPIPVPVYCGNFP 131 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +3 Query: 390 NTYFCFNERVYRICYSSVQSLSFLWVESPVFAGLCP 497 N Y +N+ Y Y ++ + + + PV+ G P Sbjct: 96 NNYNNYNKHNYNKLYYNINYIEQIPIPVPVYCGNFP 131 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +3 Query: 390 NTYFCFNERVYRICYSSVQSLSFLWVESPVFAGLCP 497 N Y +N+ Y Y ++ + + + PV+ G P Sbjct: 96 NNYNNYNKHNYNKLYYNINYIEQIPIPVPVYCGNFP 131 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +3 Query: 390 NTYFCFNERVYRICYSSVQSLSFLWVESPVFAGLCP 497 N Y +N+ Y Y ++ + + + PV+ G P Sbjct: 96 NNYNNYNKHNYNKLYYNINYIEQIPIPVPVYCGNFP 131 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +3 Query: 390 NTYFCFNERVYRICYSSVQSLSFLWVESPVFAGLCP 497 N Y +N+ Y Y ++ + + + PV+ G P Sbjct: 96 NNYNNYNKHNYNKLYYNINYIEQIPIPVPVYCGNFP 131 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +3 Query: 390 NTYFCFNERVYRICYSSVQSLSFLWVESPVFAGLCP 497 N Y +N+ Y Y ++ + + + PV+ G P Sbjct: 329 NNYNNYNKHNYNKLYYNINYIEQIPIPVPVYCGNFP 364 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +3 Query: 390 NTYFCFNERVYRICYSSVQSLSFLWVESPVFAGLCP 497 N Y +N+ Y Y ++ + + + PV+ G P Sbjct: 329 NNYNNYNKHNYNKLYYNINYIEQIPIPVPVYCGNFP 364 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,171 Number of Sequences: 438 Number of extensions: 4148 Number of successful extensions: 17 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -